SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15922698|ref|NP_378367.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15922698|ref|NP_378367.1|
Domain Number 1 Region: 107-372
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.1e-78
Family D-glucarate dehydratase-like 0.0000268
Further Details:      
 
Domain Number 2 Region: 4-124
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 6.91e-25
Family Enolase N-terminal domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15922698|ref|NP_378367.1|
Sequence length 396
Comment hypothetical protein ST2366 [Sulfolobus tokodaii str. 7]
Sequence
MAKISEIEPLVLAHTEKGSATWASVMIVVKVVTSNGMVGYGESVPTLRVINVYNTIKQVS
KGYIGKEAEEPEENYQEWYKQDFYLARSFESATATSAIDQALWDIVGKELGAPIYKLLGG
KVRDKIPVYANGWYQDAITPEDFAEKAKEVVKRGYKALKFDPFGPYYNWIDEKGLKEAEE
RVKAVREAVGNDVDILIEHHGRFNADSAILIAKRLEKYNPMFMEEPVHHEDIEGLRKYRQ
HTSLNIALGERLISLKETAVYVSEGLVNILQPDLCNIGGITVGRKVISLAEAFDVEIAFH
NAFGSIQNAYSLQMSAITPNLYLLENFYDWFPQWKRDIVFDETKVENGHVKVPDKPGIGV
SINEKLVESLKVEPKELEVQEEPVWVVKGTWKKYLT
Download sequence
Identical sequences Q96Y01
gi|15922698|ref|NP_378367.1| 273063.ST2366 WP_010980451.1.60790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]