SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15922812|ref|NP_378481.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15922812|ref|NP_378481.1|
Domain Number 1 Region: 178-264
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000405
Family Multidrug resistance efflux transporter EmrE 0.022
Further Details:      
 
Weak hits

Sequence:  gi|15922812|ref|NP_378481.1|
Domain Number - Region: 46-127
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000392
Family Multidrug resistance efflux transporter EmrE 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15922812|ref|NP_378481.1|
Sequence length 265
Comment hypothetical protein ST2480 [Sulfolobus tokodaii str. 7]
Sequence
MNKYYVLLIAGGITFGTASIFIKLSNMTPGALAFFRFFIVGLIFSLVSRVNFRKILKYSP
FGFLLALHMITFIISVYTTTIIDATVLVSTSPFFVILLSRFTKFKNTIKDIVGSVIGFMG
VALINYPLVLGYLVGNIIAIFSAFLIALYTALLSRVEEDSISLTSAIYLSSSIFTFPLFI
VQGFGKIDLTSVLSLLGLIFLPTLIGHTSVIVASGKVKPQHIEIIGLLEPVTASILAVFI
FHQIPTAFQVMGSALILFSVVYIMT
Download sequence
Identical sequences Q96XN7
gi|15922812|ref|NP_378481.1| WP_010980565.1.60790 273063.ST2480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]