SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15922841|ref|NP_378510.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15922841|ref|NP_378510.1|
Domain Number 1 Region: 5-67
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000873
Family C-terminal domain of RPA32 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15922841|ref|NP_378510.1|
Sequence length 68
Comment hypothetical protein STS249 [Sulfolobus tokodaii str. 7]
Sequence
MLSELKEKILSIINSYNRPVLFKDIKDQLNISTDALKRELNDLIKEGLIKKEKGRYALTE
AGKKSLQR
Download sequence
Identical sequences Q96XK8
273063.STS249 WP_010980594.1.60790 gi|15922841|ref|NP_378510.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]