SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15922879|ref|NP_378548.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15922879|ref|NP_378548.1|
Domain Number 1 Region: 242-580
Classification Level Classification E-value
Superfamily SIS domain 1.95e-73
Family double-SIS domain 0.0000197
Further Details:      
 
Domain Number 2 Region: 3-220
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.12e-43
Family Class II glutamine amidotransferases 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15922879|ref|NP_378548.1|
Sequence length 581
Comment glucosamine--fructose-6-phosphate aminotransferase [Sulfolobus tokodaii str. 7]
Sequence
MGGIFGFICKNPRDVSIINIGLKRLIYRGYDSAGIAYEKDSSLEVIKMLGNIARNELKVN
DKSKVALGHTRYASRGWPTLNNAHPITDCKGEIGLVMDGILYDYEVLREKLEREGHKFVT
TTDTEVLPHYLEGNYEEKLKGIWNVIKGLYSFAFIVKGVEKIFAVNAGQGLYIGISNECF
FISSDLPSLTGFAENAIIVPENTYVILSPDSFKIFNTQGEVNGELKRVKYKEEIADKGGF
SHFMLKEIYDIPLSLINSVNSLMEKYLSLASMIIANARKVYIIANGSSLHAGYISSYYLH
DVSLNVVSAAEFPYYALDNITTGTVVIAISQSGETSDVIRSVKLAKQRGAVILGITNSVG
SRLALESNVYLPITAGPELAVPATKTFTSTIIVLKILSDYVSYQLGKIDKKDIDHDKNEI
QRLSKLVLDSLPYMEKRAEELVNLIDKESLYVASSGINYPIALEGALKFKEASLTHAEGI
QLGELLHGPIVLANKGYPILIIKPAEEQAEDLYNKVIKLAKDRGSPIITISPEGDFRSVK
TTRDLSPIANVIPLQLLAYKLGVKKELPIDTPVGLVKAVTI
Download sequence
Identical sequences F9VPH3
WP_010980632.1.60790 gi|15922879|ref|NP_378548.1| 273063.ST2545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]