SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15922887|ref|NP_378556.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15922887|ref|NP_378556.1|
Domain Number 1 Region: 1-128
Classification Level Classification E-value
Superfamily Transposase IS200-like 5.89e-50
Family Transposase IS200-like 0.000000594
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15922887|ref|NP_378556.1|
Sequence length 136
Comment transposase [Sulfolobus tokodaii str. 7]
Sequence
MEYKSTRHAKYLCNYHFVWIPKYRRKVLTGEIAEYTKEVLRTIAEELGCEVLALEVMPDH
IHLFVNCPPRYAPSYLANYFKGKSARLILKKFPELKKATNGKLWTRSYFVSTSGNISSET
IKKYIEEQWVKEGEED
Download sequence
Identical sequences Q96X60
gi|15920220|ref|NP_375889.1| gi|15922887|ref|NP_378556.1| 273063.ST0043 273063.ST2553 WP_010977980.1.60790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]