SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15920893|ref|NP_376562.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15920893|ref|NP_376562.1|
Domain Number 1 Region: 70-152
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000282
Family Cgl2762-like 0.042
Further Details:      
 
Weak hits

Sequence:  gi|15920893|ref|NP_376562.1|
Domain Number - Region: 28-68
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0111
Family Transcriptional factor domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15920893|ref|NP_376562.1|
Sequence length 265
Comment insertion element protein [Sulfolobus tokodaii str. 7]
Sequence
MSSLGDSVVIKLFIFVLRVLLMGRKPVFRQDLACPSCGSHHVVKCGKPLGRQRFLCRDCG
KYFLADAIYHHHSKEVREKALRMYTNGMSMRAISRVLNVPLGTVFTWIKRYGKRKYEKLV
DLWNKAKELVKGKVVTKVVDEMWTYLYRNTRAFYKWVFTCYVYTRLGLYIIYSVGDRDEN
TFREVKDYVPDDGRWVSDDYNVYFWLKNHTVVSLVNPNEGLHSSLRDRLVRFKRATKAVN
RSINMVKYSIALVLWERRLIPEFVA
Download sequence
Identical sequences Q974I7
273063.ST0671 gi|15920893|ref|NP_376562.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]