SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|223476936|ref|YP_002581290.1| from Thermococcus sp. AM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|223476936|ref|YP_002581290.1|
Domain Number 1 Region: 755-1128,1161-1236
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 3.36e-140
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00028
Further Details:      
 
Domain Number 2 Region: 430-527
Classification Level Classification E-value
Superfamily Homing endonucleases 3.91e-43
Family Intein endonuclease 0.0000114
Further Details:      
 
Domain Number 3 Region: 302-430,716-756
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.55e-41
Family Intein (protein splicing domain) 0.000000891
Further Details:      
 
Domain Number 4 Region: 637-715
Classification Level Classification E-value
Superfamily YcfA/nrd intein domain 8.63e-39
Family PI-Pfui intein middle domain 0.0000207
Further Details:      
 
Domain Number 5 Region: 528-632
Classification Level Classification E-value
Superfamily Homing endonucleases 7.94e-23
Family Intein endonuclease 0.0000192
Further Details:      
 
Domain Number 6 Region: 9-154
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.00000000000785
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.006
Further Details:      
 
Domain Number 7 Region: 234-302
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 0.00000763
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|223476936|ref|YP_002581290.1|
Sequence length 1361
Comment ribonucleoside-diphosphate reductase, coenzyme B12-dependent [Thermococcus sp. AM4]
Sequence
MAVEKVMKRDGRIVPFDRERIKWAIKRAMLEVGVHDDKLLNRVVRRVVRRINELYDGQVP
HIENIQDIVELELMRAGLFEVAKAYILYRKKKAEIREEKKKILNKDKLDEIDKRFSLNAL
RVLASRYLIRNEKGEIVESPRELFERVATLAVIPDLLYDERVYDKEGKHEQDLSRVKHYL
EHFEEFDGKYSIGRFKLNKYHFERLVKLYRELAEKGKMKVSIDEFLGMLENGAFDDYESE
IEEYFRLMTSQTFMPNTPALINSGRPLGMLSACFVVPIEDDMESIMKAAHDVAMIQKSGG
GCIDGNAKILFENEGEEHLTTMAEMYERYKHLGEFYDKNYNRWGIDVSSVPIYVKSFDPE
TGEVVRGRVKAIWRYELGEKVTKYNIKTNKGTRILTSPWHPFFVLNPDFKVVEKRADELS
EGDMLVGGMPEDDNHEFIFDYWLAGFIAGDGSFDKQRSHVKGHEYIYDRLRIYDYRVETF
ETINKYLEETFGKRYSLQRDRNIYYIDIKAREITSHYRKLLDGIDTGIPPEILRKGRAAV
LSFITGLFDAEGHVNSKPGVELGMVNRKLIEDIAHYLSSLGIKARMREKPRKDGVDYIVH
VEEYSSLLRFYELIGKNLQNEEKRKKLETLLEKHKGGTFGLSLNFEAFKRWASKHGVEFK
TNGSQTLAIIKGEKISLGQWHTRGRVSKAVLVKMLRKLYDATGVEDVKRMLHLVEGLEVV
KEITTTNEPKTFYDLTVENYQNYLAGENGMVFVHNTGLNFSKLRPEGDFVGSTAGAASGP
VSFMHLIDAVSDVIKQGGVRRGANMGILEVWHPDIEKFIHAKERNTGTNVLSNFNISVGI
WEDFWEALKEGKRYPLVNPRTGEKVKEIDPKSLFEELAFMAWSKADPGVIFFDVINRRNV
LAEAKGGPIRATNPCGEEPLYEYESCNLASINLAKFVKYDDEGKPYFDWDEYAYVIQKVA
KYLDNAIDVNRFPLPEIDHNTKLTRRIGVGMMGLADALFKLGIPYNSEEGFAFMRKATEY
LTFYAYKYSVEAAKKRGTFPLYEKSAYKDGELPVEGFYHREIWTLPWDELVEEIKRHGVR
NGMVTTCPPTGSVSMIADTSSGIEPIFALVYKKSVTVGEFYYVDPVFESELKKRGLWSDE
ILRKISDNYGSVQGLEEIPEDMQRVFVTSMDVHWLDHILAQANIQLWLTDSASKTINMPN
DATVEDVKAAYLLAYKLGCKGITVYRDGSLSVQVYSVEGEKRKRVPAKPSSYAVEKLKAV
VEAEPWLAKFINVEAILNGTNGKEKPQLSFSLSTAKAVTPKTPEHPHHAEKPEVPEEKIK
ELLGVAYCPVCYEKDGELVELRMESGCATCPRCGWSKCVIS
Download sequence
Identical sequences B7R5G0
WP_014123146.1.59639 gi|223476936|ref|YP_002581290.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]