SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|223477308|ref|YP_002581845.1| from Thermococcus sp. AM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|223477308|ref|YP_002581845.1|
Domain Number 1 Region: 651-983
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 4.88e-62
Family Class III anaerobic ribonucleotide reductase NRDD subunit 0.0094
Further Details:      
 
Domain Number 2 Region: 23-296
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 4.88e-59
Family Class III anaerobic ribonucleotide reductase NRDD subunit 0.0075
Further Details:      
 
Domain Number 3 Region: 278-402,627-665
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 8.24e-24
Family Intein (protein splicing domain) 0.014
Further Details:      
 
Domain Number 4 Region: 530-597
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000000157
Family Intein endonuclease 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|223477308|ref|YP_002581845.1|
Sequence length 1001
Comment anaeobic ribonucleotide-triphosphate reductase [Thermococcus sp. AM4]
Sequence
METVKRDIIQEYAGWSSLDVLENANRYPGPTGFFAYVMEESLKESISLVPKEGREAHFSG
DIYIHKLPYSLYIPYCTGHSTARLLEKGLKTPTIVSRPARHFDTYVDHIANYLITMQHYF
SGAQALSSVEWYAGPFIRKESLDRRKIRQQIQRLVYNLNYPTRIGLQTPFTNFTVTLDAP
KKMLEGDHAVYAGEKVEPLGEYEREAKEFFIALTEVLREGDALGQPFTFPIPTLMVTAKM
LWDDPEVFEEVFGTASKRGSFYWLNTNVVDPDASYAMCLYENENVLYRANGDIGVAPIQE
LFERFAGELESREDDGAEWYGVRDTVEVLAVDPKGEKVEWKPIKRFLKKEYGKAIRVHLS
DGRSFVVSPDHPIPVLVKYDNSVRLMKAEELAKRSLGGYAYRIPVVLTEIEGEKAKLQLE
DGREIDVNEDFGYFMGLFYGDGTFIRSSDMARRTREEKHREGYYLSGIQFSINSAEKDVK
EFLVQFSINVLGREPKVKRDPRWESLTYVRIYDAYLARALYDEGVSGLSHEKRIPGVIWR
APAKVRRAFLKGLLHSDGYWRKGAWELHIKNRELAEGVLTLSAITGISAYFRENRDGSVV
VYFPGSWGEEIGRPSEAVKHRVSGNLAWVTVLEAEEIEVGGTFYDVEVEGIHYFTHSSGV
VTHNCCRIAIDKTEMAFAFGVSEKSAEEEALERLERGRFGGLWAMPDVTGSVNVTTVNLP
KLALKAGGDDDKFWEEYERVLEVVRRTTDWFRERYVRLITAYRHMYSMIHLYLEEFPGSH
FNTVGILGLPEAASIYLNEPKLWEEGTRKDWLRAAELMKEMVEFATVKAREWMKETGTPW
NVEEVPGESAAAKLAIKDLREFPELKEYLSDPENPIYSTSVAPYYGSLELADRIRVEEKI
QRSFTGGVMMHIFLGEEPDPGALAKLTKRLMRTELVYWSYTPAITVCNDCNYSTTGLHTH
CPRCGSKNVEIWSRIIGYYRPLKNWNPFRKKEFWTRRHYSS
Download sequence
Identical sequences B7R3M9
WP_014122853.1.59639 gi|223477308|ref|YP_002581845.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]