SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|223477431|ref|YP_002582051.1| from Thermococcus sp. AM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|223477431|ref|YP_002582051.1|
Domain Number 1 Region: 3-100
Classification Level Classification E-value
Superfamily GlnB-like 7.04e-32
Family Divalent ion tolerance proteins CutA (CutA1) 0.0000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|223477431|ref|YP_002582051.1|
Sequence length 104
Comment divalent-cation tolerance protein CutA [Thermococcus sp. AM4]
Sequence
MEAILVYTTFPDWESARRIVRELLEKKLIVCANLREHEAMYWWDGKIEEGREVGAILKTD
VSKWKELRNTLRELHPYEVPMIARIDLDKLNREYSEWMEKVLFG
Download sequence
Identical sequences B7R482
WP_014123049.1.59639 gi|223477431|ref|YP_002582051.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]