SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|223477529|ref|YP_002581879.1| from Thermococcus sp. AM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|223477529|ref|YP_002581879.1|
Domain Number 1 Region: 258-514
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.06e-47
Family RecA protein-like (ATPase-domain) 0.00042
Further Details:      
 
Domain Number 2 Region: 510-641,694-710,961-1030
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 6.54e-37
Family Intein (protein splicing domain) 0.0033
Further Details:      
 
Domain Number 3 Region: 781-888
Classification Level Classification E-value
Superfamily Homing endonucleases 4.13e-21
Family Intein endonuclease 0.0052
Further Details:      
 
Weak hits

Sequence:  gi|223477529|ref|YP_002581879.1|
Domain Number - Region: 697-773
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00153
Family Group I mobile intron endonuclease 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|223477529|ref|YP_002581879.1|
Sequence length 1194
Comment Type II/IV secretion system protein kinase [Thermococcus sp. AM4]
Sequence
MEKKKKKELSGSWIDEILGGKSDPLANVLGEKKEEKKPPLPFISEGSPLEEILGGSKKEE
PKKPPVPAGNPLEEILKSAEKPKEESPAPSLSAILGGKEGKEKPSERQKKPETPTGVDLL
GQILGGSTGTAPSKPKAPARSQPLPLPLPKPKPSLGLQSIIGETKTEELSYGGRAKVLDA
YGNVRILKVKGEPVPIYEIRLPKLSKDEENLLKQVRERAITEIQIDPTLIPNYEERRKIF
LREVKRMLKEAAPNFSEGRIEVLAELIVQSMLGYGLLDPLVRDDNLEEIMVIGTNKPVYV
WHRRFYMCKTNIVFKEERDILNIIERIAREVGRRIDQQNPLLDARLPDGSRVNATIPPIS
LDGPTITIRKFKKDPLTIIDLIKYGTMNSDVAAFLWLLVDGLGVKPANILVAGGTGSGKT
TTLNALAMFIPPSERVISIEDTAELQLPVEHWVRLETRPPNIEGKGEVTMDDLVKNTLRM
RPDRIIVGEVRGPEARTMFTAMNTGHNGALYDFSVIQLSDGRFVLIGDLLEELFRKYSDR
IETYRDLEYVVLDEEDRFEVVSVGPDLKAGKHVVSRVWRRKVREGEKLIRVRTRTGNEVI
LTKTHPFFVFSDGDVVRKEAEKLKPGDRVAVMRKPPRPPQRRAIINPEVYAGISDYYLVP
NGNGLVKVPNDGIPPEMAQYLLSINSKPVKLVREVNESLSYAVGVLLGDGYISSNGYYIS
ATFDDESYMKAFTSAISEFLPESEPQVKRESAYTVVTYGSRPFAEFLHRAFGIPKGRKES
LDVPDLVLSNDDLLRHFIAGLFDADAYIDENGPAVILTTRSENLARKVWYALQRLGIIST
VSRVKNRGYKEGVIFRVTVRGVEDLIRFHRSIPLRHSRKREKLEELIRKYRSYRGKRADR
VPISPAMLEPLRRRLNLTVSELSRLASSYAGEKVSESLIRHVEKGRMKEIRRSALRGIAL
ALQQVASDLRDKEAWVQAKRLELIAEGDVYWDEVVSVEEVEPEELGIEYLYDLTVEEDHN
YVANGILVSNCMGTIHSNSARETIVRLESPPMNVPRIMIPALDIILMQVRFNSRKKGTVR
RVTEIAEISGIEGESIQLNKLYKYDPAKDELQPTEVPSRVINELARHTGMSISELEMERE
KRKIILEWMMEKGIRSIEEVGHYIKMFYIDEDALIEKIERDSSAQIQEQIRNIA
Download sequence
Identical sequences B7R3R0
gi|223477529|ref|YP_002581879.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]