SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|223477981|ref|YP_002582218.1| from Thermococcus sp. AM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|223477981|ref|YP_002582218.1|
Domain Number 1 Region: 10-247
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.82e-65
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.0000298
Further Details:      
 
Domain Number 2 Region: 335-520
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 4.91e-43
Family Intein (protein splicing domain) 0.0007
Further Details:      
 
Domain Number 3 Region: 575-697,789-805,1042-1107
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.19e-34
Family Intein (protein splicing domain) 0.0081
Further Details:      
 
Domain Number 4 Region: 1133-1252,1424-1463
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.29e-29
Family Intein (protein splicing domain) 0.068
Further Details:      
 
Domain Number 5 Region: 1461-1638
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.46e-22
Family Extended AAA-ATPase domain 0.042
Further Details:      
 
Domain Number 6 Region: 889-982
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000416
Family Group I mobile intron endonuclease 0.036
Further Details:      
 
Weak hits

Sequence:  gi|223477981|ref|YP_002582218.1|
Domain Number - Region: 793-838
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00619
Family Group I mobile intron endonuclease 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|223477981|ref|YP_002582218.1|
Sequence length 1731
Comment DNA replication helicase protein MCM [Thermococcus sp. AM4]
Sequence
MDREDMISRFATFLREYKDDDGNPVYLNRLKDLLTVVPKRSLTVDWAHLNSFDPELAEEL
LENPEEVLMAGEDAIQIVLREDLMYSEELKIHARFYNLPHTLLVKELGSEHINRLIQVEG
IITRVSEVKPFVQKAVFVCKDCGNEMIRLQRPYENLVKPAKCDACGSRNVELDVEKSRFI
NFQSFRLQDRPESLKGGQMPRFVDAILLDDLVDTALPGDRVLVTGILRVILEQRDKRPIF
KKVLEVNHIEQLSKEIEELEISPEDEQKIRELAKRKDIVDAIVDSIAPAIWGHRIVKKGI
ALALFGGVQRVLPDGTKLRGESHVLLVGDPGVAKCVDYHTKVLLADGSLKEIGEIVDEAI
EKAKAEGKLGRVDDGFYAPIDLELYALDAKTLKVRRVKANIAWKRTAPEKMFRIRTSSGR
EIRVTPTHPFFTFENGQFRTRKAEELRVGDFIATPRRDNEPKIVPETEDEGIRKLLEESD
IFWDRVVEIEEYKPEHEWVYDLQIPEHHNFIANDIFVHNSQLLRYVANLAPRAIYTSGKS
SSAAGLTAAAVRDEFTGSWVLEAGVLVLADGGFACLHPDSRVLVDGKYQRIEDLFELEKS
YKALSDGQIVDIQEKEMEVTALNLGSMRTKTSKATIIRRKPWKGELLKLKFRSGNEVTLT
PDHLLIDGQTLEWKEAEKFKVGDMVVAPLKLPSVGRRVHLLDILPPDWKVKLTPEEKNEL
KREILRRFKSLAEFNKEYGISKDFLSGKGSIRVGKFREILRELGLYEKWRERPLTYGPNY
RRERLKVAYITPELAYFLGFLYGDGWIKRNGSKVHVRIVQSKVHKDQIRAIRRAFESFYD
GPLREYERTTRSELAGNEIESDAITFHVSSPLLAYLYEYLTEDNLKNAFSLDDEALRAFI
AGALDSDGCVSVKKSERGSVVHIEFLLSNDVERDKAFALLLRRFDVYARVIPGKGVNRVR
VTGREDVINLLNAVKDYSVKVKEIPLKKHLVSARSDKVPAEPVRKIARAIIESVPAKVLQ
ERGLWSTVYSYAKGKYQPSRIQLRKLIERLGNVLSPEIRIKLEVLATRDYLLDEIVSIER
VPYEGYVYDLYVPGEHNFLAEGIIVHNCIDEFDKMSDRDRSAIHEALEQQSYHHDFELLL
ADGRKVKIGELVDSLIEANRDKVIIGNDTEILPVDDIELLAYDLERREIVKVKADRVSRH
RAPDRFIRLRFSNGREVTVTPEHPIMVWENGEIREKPAEEVAIDDVVLGVARYPVEIEQP
DEPARDKKAAWDRQDYLYSLGIVSKIKKAPGRYEVTPVERTFPGELLKKLEEAGKNVRFK
LSNRYYARKPLVSESLLREEIRRLREHVELVRELANREPLRALDYLNKSRIAFKYGISSL
TLRHRIERNDPTALSILRTEVENEAERIERVIEEIEGFLNGNVNFLRVKGTEVIPNDSWE
WVYDVTVEPYHLFVSHGLVLHNTISISKAGITATLNARTTVIAAANPKFGRFNRMKSLPE
QLDLPPTLLSRFDLIFLLLDEPDEKIDASIAEHILRVRRGEAEVVTPKIPYDLLKKYIAY
ARKNVHPVLSREAMEEIKRYYVKMRKGLKRGNEEGVQPIPITARQLEALIRLSEAHARMR
LSETVTREDARAAIELIEAMMRTIAVDEEGNIDVSILEIGKSSKKLNKIEKLVDIIKNLE
PEGEYGAPADKVIEAAKQAGVGGKREVEKIIEELKAEGRIYEPRAGFYRVL
Download sequence
Identical sequences B7R2N7
WP_014122582.1.59639 gi|223477981|ref|YP_002582218.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]