SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|223478253|ref|YP_002582729.1| from Thermococcus sp. AM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|223478253|ref|YP_002582729.1|
Domain Number 1 Region: 637-961
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 2.62e-76
Family Prokaryotic type I DNA topoisomerase 0.0000000536
Further Details:      
 
Domain Number 2 Region: 1448-1704
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 1.96e-58
Family Prokaryotic type I DNA topoisomerase 0.00000232
Further Details:      
 
Domain Number 3 Region: 326-461,510-624
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.76e-39
Family Helicase-like "domain" of reverse gyrase 0.00012
Further Details:      
 
Domain Number 4 Region: 41-242
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.68e-34
Family Helicase-like "domain" of reverse gyrase 0.0000547
Further Details:      
 
Domain Number 5 Region: 961-1067,1152-1168,1384-1448
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.98e-29
Family Intein (protein splicing domain) 0.0096
Further Details:      
 
Domain Number 6 Region: 1233-1316
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000000000529
Family Group I mobile intron endonuclease 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|223478253|ref|YP_002582729.1|
Sequence length 1714
Comment DNA reverse gyrase [Thermococcus sp. AM4]
Sequence
MKALYREMCPNCRGRISDERLSMRNPCESCLNEPIAIDSYFELVSAVRDALLNASRLKDW
ERIYRLESETREIEDFFRKATGFTFWSAQRTWVKRLLKGRSFSIIAPTGMGKSTFGAFMS
VYYATKGKKSYIVVPTTPLVIQTIRKVQAIIERTGLNVNLAYYHGNLRKKEKEEMLAKIE
SGDYDILITSAQWLARNFDEKLKGRHFDFIFVDDVDAFLKASKNIDRSLLLLGFTEEIIG
KAWEIIRLKKQMARYLNGNSQDKNDRLKELNEAIEKIQREIEEFKRKNDIGIMIIASATG
SARGDRIKLYRELLGFEVGSGRSALRNVVDSYLKPSKDVKEHVEELLRKLGKGGLIFVPI
DQGLSYAEELVDYLKERGFAVELASSKNKKAVERFENGEADYLVGVATYYGSIVRGLDLP
HLIRYAVFTGVPKFRFSIDLERPTIYRALGLLSEVMDFLDDEDRRKAEKLHARLRRLIRN
IPQFELLKIEEALAEGLPIENDFHKTVLNVFRELVEFLREVLKKEDVLKRLAEDPFVSLV
KEEGKWFIEIPDVRTYIQATGRTSRLFAGGITKGLSVLIVDNEKVFNGLVRQMRWRFTEF
KMVPFEELDLEKLLKEIDEDREKVKLVMEGKISSKVKDLVKSALMIVESPNKARTIANFF
GRPSKTRIGELVAYEVSVGDKMLTILASGGHMFDLVTNEGYHGVLIEREGDMLKFIPVYD
TIKRCRDCGYQFVDWEERGVCPRCGSRNVHDALENVKAMREIAQEVDEILIATDPDTEGE
KIAWDIRNVLAPYTPNIKRVEFHEVTRPAIMKAIREARDVNEARVEAQMVRRIEDRWIGF
ELSQELQRVFENRNLSAGRVQTPVLGWIIERYKEFTESEVYFLGLTLENGLQVTVELGKD
GKDVEPPEYVTVEEVQLEERELNPAPPYTTDAMLRDASTFLKLSAPETMRLAQDLFEAGL
CVTPDTVVTLADGRIMRIKDAVRSKEGNLLAVNGLKAKNAKATKFWEINWNGPLKVVRLQ
NGHEIRATPDHGLLVLRDGKLGWVSTKNIEPGDYVAFAYNTGHKGTREYTLLEMLIELGI
TDVMVELKGEYFDSKIAPLVRERIKTSTKYKYLRNRVVPLAKLVEWGVDDYEPHVVSIYR
QRAGSRRIPNFKLDENFWYVFGLVLGDGTLRGSKVLISQTPLKQVKEILEETFPFLHVFE
TTNQVGFSNSILVELFRRLGGRSGELNPIIFTIPEKMLNAMIAGYFDTDGTFSLLHDKRG
VNFRALLTSKRGDVLKKLSVYLYQVGILNYLKRDKRTGVWDLIISNRSLGIFREKIYPYL
RIRRAQFEETYSAYRRTRKPNESDTIPIGALIKELIFPNGTKARLLREEGIDIWNWLKKP
GSVPRNKLAKVLEYVEDNEVKDYLRSLVEANVTWVKVVDVDEEHYTGKLYDFTTTTENFI
ANGAVSHNCTYHRTDSTHVSSTGIEIAKEYITSELGEEYFKPRPWGEEGTHEAIRPTRPI
DTGRLMQLIRDGVIQLPRNLTRNHYRLYDMIFRRFMTSQMVPAVILHERAVINAGVGKVE
LEGYVEILKDGWTKLRSPPLRQLPKLEPGAKLKVVEFKKWKAPKVSLYTQGDIIALMKER
GIGRPSTYAKIVQTLLQRYYVFETRGRKKLVPTEKGIKVYHYLISKYRELVSEEKTRELE
EKMDLIEEGKLNYLEVLNELYREIACEIRKEGCS
Download sequence
Identical sequences B7R1X7
gi|223478253|ref|YP_002582729.1| WP_014122201.1.59639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]