SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|223478327|ref|YP_002582532.1| from Thermococcus sp. AM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|223478327|ref|YP_002582532.1|
Domain Number 1 Region: 1-347
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.64e-88
Family DnaQ-like 3'-5' exonuclease 0.00000000000486
Further Details:      
 
Domain Number 2 Region: 1027-1077,1467-1683
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 7.05e-76
Family DNA polymerase I 0.00000000233
Further Details:      
 
Domain Number 3 Region: 349-493
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.61e-43
Family DNA polymerase I 0.0000000688
Further Details:      
 
Domain Number 4 Region: 492-616,990-1029
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 9.03e-38
Family Intein (protein splicing domain) 0.014
Further Details:      
 
Domain Number 5 Region: 1078-1187,1430-1467
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.06e-24
Family Intein (protein splicing domain) 0.019
Further Details:      
 
Domain Number 6 Region: 1302-1415
Classification Level Classification E-value
Superfamily Homing endonucleases 2.04e-19
Family Intein endonuclease 0.063
Further Details:      
 
Domain Number 7 Region: 848-938
Classification Level Classification E-value
Superfamily Homing endonucleases 4.82e-18
Family Group I mobile intron endonuclease 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|223478327|ref|YP_002582532.1|
Sequence length 1699
Comment DNA polymerase family B [Thermococcus sp. AM4]
Sequence
MILDTDYITENGKPVIRVFKKENGEFKIEYDRTFEPYFYALLKDDSAIEDVKKVTAKRHG
TVVRVKRAEKVQRKFLGRPIEVWKLYFTHPQDVPAIRDKIRAHPAVIDIYEYDIPFAKRY
LIDKGLIPMEGDEELTMLAFDIETLYHEGEEFGTGPILMISYADGSEARVITWKKIDLPY
VDVVSTEKEMIKRFLRIVKEKDPDVLITYNGDNFDFAYLKKRCEKLGIKFTLGRDGSEPK
IQRMGDRFAVEVKGRIHFDLYPVIRRTINLPTYTLEAVYEAVFGKPKEKVYAEEIAQAWE
SGEGLERVARYSMEDAKVTYELGREFFPMEAQLSRLIGQSLWDVSRSSTGNLVEWFLLRK
AYERNELAPNKPDEKELARRRGGYAGGYVKEPERGLWDNIVYLDFRSLYPSIIITHNVSP
DTLNREGCKEYDVAPEVGHKFCKDFPGFIPSLLGDLLEERQKIKRKMKATVDPLEKKLLD
YRQRAIKILANSLLPEEWIPVVKNGDIKLVRIGEFVDGLMKDEKERVKRDGNTEVLEVTG
IRAVSFDRKTKKARLMPVKALIRHRYSGNVYEITLSSGRRITVTEGHSLFAYRNEELAEV
TGGEIRAGDLLAVPKRVRLPERKETLNIVQLLLELPEEETEDIVLTIPTRGRKNFFKGML
RTLRWIFGEEKRPRTARRYLKHLEELGYVKLRKIGYEIIDGEGLKKYRTLYEGLVEAVRY
NRNRKEYLIEFNAVRDVIALMPEEELKEWKIGTRNGFKMSPFIEVDENFAKLLGYYVSEG
YAGKQRNPKNGRSCSVKLYNNDESVLDDMERLSERFFGKVRRGKNYVEIPKKMACIIFEA
LCGTLAENKRVPEVIFTSPESVRWAFLEGYFIGDGDVHPNKRVRLSTKSEILVNGLVLLL
NSLGVSAIRLRYDSGVYRVYVNEELPFTDYKKKKNAYYSHVIPKEVLEETFGKVFQKNMS
YEKFRELVDNGRLDGEKAKRIKWLISGDIVLDRVVEVKKRHYEGHVYDLSVEEDENFLAG
FGLLYAHNSYYGYYGYAKARWYCRECAESVTAWGREYIETTIREIEEKFGFKVLYADSVT
GETEIIIRRNGKVEFVPIEELFQRVDYRIGEKEYCVLEGVEALTLDNRGQLVWRKVPYVM
RHRTNKRIYRVWFTNSWYLDVTEDHSLIGYLNTSRVKPGKPLRERLVEVKPEEIGKEVKS
LITPNQPIARSIKPTQTAVRLWELIGLLVGDGNWGGHSNWAKYYVGLSLGIDKEEIEEKI
LKPLKEAGIISNYYDKSKKGDVSILSKWLAGFMVRYFKDENGNKRIPNFMFSLPREYIEA
FLRGLFSADGTVSLRREIPEVRLTSVNPELSESVRKLLWLVGVSNSMFTETKPNRYLGKE
SGTHSIHVRIKNKHRFAERIGFVLDRKTSKLSENLGGYTTKKGAYQYGFDLVYPRRIEEI
PYDGYVYDIEVDGTHRFFANGILVHNTDGFFATIPGADAETVKKKAKEFLKYINAKLPGL
LELEYEGFYVRGFFVTKKKYAVIDEEGKITTRGLEIVRRDWSEIAKETQARVLEAILKHG
DVEEAVRIVKEVTEKLSKYEVPPEKLVIHEQITRDLRDYKATGPHVAVAKRLAARGVKIR
PGTVISYIVLKGSGRIGDRAIPFDEFDPTKHRYDAEYYIENQVLPAVERILKAFGYRKED
LRYQKTKQVGLGAWLKVKK
Download sequence
Identical sequences B7R1D4
gi|223478327|ref|YP_002582532.1| WP_014121997.1.59639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]