SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|223478343|ref|YP_002582719.1| from Thermococcus sp. AM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|223478343|ref|YP_002582719.1|
Domain Number 1 Region: 8-107
Classification Level Classification E-value
Superfamily GlnB-like 1.41e-34
Family DUF190/COG1993 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|223478343|ref|YP_002582719.1|
Sequence length 127
Comment hypothetical protein [Thermococcus sp. AM4]
Sequence
MVEVEHWNTLRLKIYIGENDRWKGRPLYKAIVEKLREMGMAGATVYRGIYGFGKKSRIHS
GDIMRLSTDLPVMIEVVDRGYKIEKAICEIKPMINDGMITVEPVIVVWVGSQDEVSKFRE
DAVREES
Download sequence
Identical sequences B7R1V2
gi|223478343|ref|YP_002582719.1| WP_014122191.1.59639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]