SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|223478975|ref|YP_002583000.1| from Thermococcus sp. AM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|223478975|ref|YP_002583000.1|
Domain Number 1 Region: 21-231
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.35e-39
Family Tandem AAA-ATPase domain 0.0005
Further Details:      
 
Domain Number 2 Region: 348-451,545-561,809-873
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 4.32e-29
Family Intein (protein splicing domain) 0.014
Further Details:      
 
Domain Number 3 Region: 266-350,877-936
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.04e-19
Family Tandem AAA-ATPase domain 0.0092
Further Details:      
 
Domain Number 4 Region: 631-737
Classification Level Classification E-value
Superfamily Homing endonucleases 2.92e-17
Family Intein endonuclease 0.027
Further Details:      
 
Weak hits

Sequence:  gi|223478975|ref|YP_002583000.1|
Domain Number - Region: 550-608
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00113
Family Intein endonuclease 0.031
Further Details:      
 
Domain Number - Region: 469-527
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0109
Family SinR domain-like 0.048
Further Details:      
 
Domain Number - Region: 761-810
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0993
Family SinR domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|223478975|ref|YP_002583000.1|
Sequence length 956
Comment Type III restriction enzyme, res subunit family [Thermococcus sp. AM4]
Sequence
MAEKRIRWARKEYSDEEIFSILSEPVREWFRRKFGSFTPPQRYAVMEIHKGENVLISSPT
GSGKTLSAFLSAINELILLGKEGKLEDKIYVLYVSPLRALNNDIKRNLEGPLAEIKEVAK
ELGYDLPEIRVGIRTSDTSSYEKSKMVKKPPHILITTPESLAIALNAPKFRERLKTVKYL
IIDEVHALAENKRGSHLALSVERLQEMAEERFVRIGLSATIHPLEEIAKFVFGFDDDGEP
RPGLIVDVSFAKQTEIKVESVVEDLIYTPAGALSEALYRRLAELIREHRTTLIFTNTRSG
AERVAFNLKKRYPEFEGLIEAHHSSLSREVRLDVEEKLKRGELKAVVCVPGHSKIITSRG
IRRIDGLSVDEEIVGVKESRSRFVEFGGTHRIEYNSTGVKLKTRLGFEVEATREHKFLTI
KDGKLTWVEVEKLKPGDYVGVLRRLPSPDEEVPIFEILPDSAYLHLRTEFLRELKKNIQT
KFCSINAFARKLGMSGSYLSKQLLGEYPFRWSKLKVVLQEVGMTLDESDVVRITSDKNSY
ELPKRFTPGLARLLGFWIADGSWKDGTVTLFSSDLDMLKHYAKLAKEELGIEGSIRKQNE
NTYSLELSFNVLFHMFREFVGNGGKKSLNGRFPEILYRLPKEHKAQFLSGYFDGDGYLEI
KEGKRVYSAGFATFNPEFAEGIRNLLLQLGIVASIRRRHYNERQFFRGREIRKTGTSYTV
AILGGEYLRKFAELVEPWRPGLRKIKEIPVEGYSNHDVIPGIGKRLRKLRETLGITSYML
QKAGFYNPVKVELGTREISRRNLVKLLNFYERVAGEGKVEGVIPEIEELRKLAEGDVFFD
RIESVESVFIADAYGILNSKTGNYVVNGFVSKNSSTSLELGIDIGTIDLVVLIGSPKSVN
RALQRIGRAGHRLHEVSKGVILALDRDDLVEVTVLAHNARNRRLDRVRIPKNRSTS
Download sequence
Identical sequences B7QZL2
gi|223478975|ref|YP_002583000.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]