SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|223479008|ref|YP_002582933.1| from Thermococcus sp. AM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|223479008|ref|YP_002582933.1|
Domain Number 1 Region: 85-167,218-371
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0000288
Family Galactose oxidase, central domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|223479008|ref|YP_002582933.1|
Sequence length 445
Comment hypothetical protein [Thermococcus sp. AM4]
Sequence
MKRLSFLIAVVLIAALLLSGVTHEGKENSLRGYWAKVYTGDHVRGGASSLVKSDDGTYLV
GWVNISNSRKGLVARLSEDGNVSRAVAYGVEGLECIFEGGLATGKSIIVAGVLFNETSIE
NKLLIAGIDQDMRPLWAETFNLSVSLVVRAVKTTDDGILVAGLMMSREKVGPFVMKLNHR
GEVLWAKRYTNASNEFLGPAEITSDGEGGFLLLGLDLEHGFSQMSLIDIDGNGNVKWAKI
YTSQEDVYGSVVLTDGKRIVVAGEVGNILAEGSTSDVFVAVFDERGNVSWAKTYGGDGID
SAGAAELIDGSIVVAGIYGGKLVPRIPITIENYSMWILNLDGEGKVLWEKAYWAGIPSFL
IQDGDSILVGGTFLSGNESKPFLSRIRWNGSAPDMGITPSYHVREIHLKAEGLGLKVETL
KVKVLPVKLELQNIPLEAEPIEIER
Download sequence
Identical sequences B7R130
gi|223479008|ref|YP_002582933.1| WP_014123236.1.59639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]