SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|223478114|ref|YP_002582576.1| from Thermococcus sp. AM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|223478114|ref|YP_002582576.1|
Domain Number 1 Region: 577-960
Classification Level Classification E-value
Superfamily Hypothetical protein PH1602 5.89e-147
Family Hypothetical protein PH1602 0.00000000000293
Further Details:      
 
Domain Number 2 Region: 2-97
Classification Level Classification E-value
Superfamily Hypothetical protein PH1602 2.22e-30
Family Hypothetical protein PH1602 0.00000263
Further Details:      
 
Domain Number 3 Region: 96-194,229-255,510-577
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 6.87e-29
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.03
Further Details:      
 
Domain Number 4 Region: 342-450
Classification Level Classification E-value
Superfamily Homing endonucleases 1.33e-17
Family Intein endonuclease 0.038
Further Details:      
 
Weak hits

Sequence:  gi|223478114|ref|YP_002582576.1|
Domain Number - Region: 247-341
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00425
Family Intein endonuclease 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|223478114|ref|YP_002582576.1|
Sequence length 960
Comment protein RtcB [Thermococcus sp. AM4]
Sequence
MVPLKRIDKIRWEIPKFDRRMRVPGRVYADDQLIEKMRQDRTLEQAANVAMLPGIYKYSI
VMPDGHQGYGFPIGGVAAFDVKEGVISPGGVGYDINCLAPGSKVLTEHGYWIKVEEMPEK
FKLQGLRVYDVDEGHNDFSQVAFVAERDVEENELAVRIITESGKVIEGSEDHPVLTPQGY
VYLGNVKEGDEVLIYPFEGVEFEERKGVLLSEDDFKGEDGQIVKFLRERKLLPLRWDDPR
IGTLARILGFAFGDGHLGEMDGRLYLSFYGKEETLKELKKDLERLGISANLYVRERDYHI
ETVSGEYEGRSVSAELRVTSRSFALLMEKLGMPRGRKAETLYNVPEWIKSAPLWVKRNFL
AGLFAADGSIVEFKGNTPLPINLTQSKAEALEENLRGFMEEIAGLLAEFGIRTTVYRVKS
KKGVTYRLALVGEESIRNFLGRINYEYDIEKKAKGLIAYAYLRFKERVRAERKRAAEIAR
RVYAETGSVAKAHEAVRDVVNKRFVERAIYEGEKEPRVPKDFPTFEEFARERGYEGGFVA
EKVVKVERVRPSYEKFYDIGVYHRAHNFIANGVVVHNCGVRLIRTNLTEKEVRPRIKELV
DTLFKNVPSGLGSKGRVRLHWTQLDDVLADGAKWAVDNGYGWKEDLEHLEEGGRMEGADP
NAVSQRAKQRGAPQLGSLGSGNHFLEVQVVDKIYDEEIAKAYGLFEGQVVVMVHTGSRGL
GHQVASDYLRIMEKANRKYGIPWPDRELVSVPFQSEEGQRYFSAMKAAANFAWANRQMIT
HWVRESFEEVFRRKAEDMEMHIVYDVAHNIAKVEEHEVDGRKVKVVVHRKGATRAFPAGH
PDVPRAYRDVGQPVLIPGSMGTASYVLAGAEGSMRETFGSSCHGAGRLLSRKAATRQYRG
DRLRNELMRRGIYVRAASLRVVAEEAPGAYKSVDNVVNVVHQAGIAKLVARMRPMGVAKG
Download sequence
Identical sequences B7R1H4
gi|223478114|ref|YP_002582576.1| WP_014122042.1.59639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]