SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78185851|ref|YP_378285.1| from Synechococcus sp. CC9902

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78185851|ref|YP_378285.1|
Domain Number 1 Region: 140-303
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.36e-39
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000163
Further Details:      
 
Domain Number 2 Region: 15-136
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.46e-29
Family Duplicated SiR/NiR-like domains 1 and 3 0.00016
Further Details:      
 
Domain Number 3 Region: 388-503
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.24e-28
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000961
Further Details:      
 
Domain Number 4 Region: 274-403
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 6.05e-19
Family Duplicated SiR/NiR-like domains 1 and 3 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78185851|ref|YP_378285.1|
Sequence length 513
Comment ferredoxin-nitrite reductase [Synechococcus sp. CC9902]
Sequence
MTASSPSKPYLDGKKLNKIEQKKADKDGLLIGTEIDQFAELGWEKVDETDLQLRLKWYGM
FWRPKTPGKFMLRLRVPNGVLSSQQLRVVASIVERYGENGSCDITTRQNLQLRGVLLGDF
PEILKRLKEVGLSSIQSGFDNPRNVTGNPLAGIDPQEIVDTRPYTTELQNFLTNNCAGNP
EFSNLPRKWNTAVAGSKDNFLLHNDIIFHPVEHNGVMGFGVWIAGILSSQLNAYALPLNA
WVKPDQICDMTAAVIKIWRDNGERDKRPKGRFRLYLDEVGLDAFRAMVEERFGPLIPDPG
SVFNTEPRSHYGIHPQKQEGLSFAGLHIPVGRLTAQDLHDFATVSLQYGSGEIRLTEDQN
VILVGLTNDTIDGLKEDPLLLRFPLEPGSIAAGTVSCTGSTYCSFALTNTKDQALKAAKE
LDAELNLPEELKIHWTGCPNTCGQAYMGAIGLTGTKAKNSNGVMGEGYTITIGGSQGANP
TLGELHQKAVPAEEIKSVLKNVLIEQFGATAKT
Download sequence
Identical sequences Q3AUI3
WP_011361018.1.34419 gi|78185851|ref|YP_378285.1| 316279.Syncc9902_2284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]