SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46198561|ref|YP_004228.1| from Thermus thermophilus HB27

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46198561|ref|YP_004228.1|
Domain Number 1 Region: 39-410
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 3.53e-111
Family Homocysteine S-methyltransferase 0.00000259
Further Details:      
 
Domain Number 2 Region: 893-1183
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 3.4e-81
Family Methionine synthase SAM-binding domain 0.00021
Further Details:      
 
Domain Number 3 Region: 368-636
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 1.57e-73
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.00016
Further Details:      
 
Domain Number 4 Region: 744-872
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 8.24e-36
Family Cobalamin (vitamin B12)-binding domain 0.00013
Further Details:      
 
Domain Number 5 Region: 661-743
Classification Level Classification E-value
Superfamily Methionine synthase domain 6.67e-27
Family Methionine synthase domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|46198561|ref|YP_004228.1|
Sequence length 1184
Comment 5-methyltetrahydrofolate--homocysteine methyltransferase [Thermus thermophilus HB27]
Sequence
MEVHACSPGCRHHLGGAGWGDAPLVRLGYNKEARAKKFPYLKALLERPLVFDGAMGTELQ
KRDLTPEDYGGEAYFGCPEVLNRTRPEVVREIHLAYLEAGAEVIETNTFGALRHVLAEYG
LEEAAEELAFLGARIAREAADPYGAFVAGALGPGTKLVSLGQISWDALYRAYKEAARGLL
KGGVDLILLETAQDILQVRCAVLAVREAMAEVGREVPLQVQVTFEATGTMLVGTDEQAAL
AALESLPVDVVGMNCATGPDLMDSKVRYFAEHSTRFVSCLPNAGLPRNEGGRVVYDLTPE
ELAKWHLKFVAEYGVNAVGGCCGTGPEHIRKVAEAVKGLAPKPRPESFPPQVASLYQAVS
LKQEASLFLVGERLNATGSKRFREMLFARDLEGILALAREQVEEGAHALDLSVAWTGRDE
LEDLRWLLPHLATALTVPVMVDSTSPEAMELALKYLPGRVLLNSANLEDGLERFDRVASL
AKAHGAALVVLAIDEKGMAKTREEKVRVALRMYERLTEHHGLRPEDLLFDLLTFPITQGD
EESRPLAKETLLAIEELRERLPGVGFVLGVSNVSFGLKPRARRVLNSVFLDEARKRGLTA
AIVDAGKILPISQIPEEAYALALDLIYDRRKEGFDPLLAFMAYFEAHKEDPGKREDAFLA
LPLLERLKRRVVEGRKQGLEADLEEALKAGHKPLDLINGPLLAGMKEVGDLFGAGKMQLP
FVLQAAEVMKRAVAYLEPHMEKKGEGKGTLVLATVKGDVHDIGKNLVDIILSNNGYRVVN
LGIKVPIEEILKAVEAHKPHAVGMSGLLVKSTLVMKENLEYMRDRGYTLPVILGGAALTR
SYVEELKAIYPNVYYAEDAFEGLRLMEELTGHAPPELTRKAPARPKREAPKVAPRARPVG
EAPAVPRPPFFGVRVEEGLDLATIAHYVNKLALYRGQWGYSRKGLSREAWQALVEREAEP
VFQRLLKEAMAEGWLEPKVLYGFFPVAREGEELLVFSPETGEVLERFRFPRQRGGGLSLV
DYFRPRFAAPLGDEADWMPKEAFRAGARDVLGVQLVTMGEAPSRKAQALFASGAYQDYLF
VHGFSVEMTEALAEYWHKRMRQMWGIAHKDATEIQKLFQQGYQGARYSFGYPACPDLADQ
AKLDRLMGFHRVGVHLTENFQLEPEHATSALVVHHPEARYFSVD
Download sequence
Identical sequences Q72L12
gi|46198561|ref|YP_004228.1| 262724.TTC0253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]