SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46199478|ref|YP_005145.1| from Thermus thermophilus HB27

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46199478|ref|YP_005145.1|
Domain Number 1 Region: 13-223
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.12e-54
Family PP-loop ATPase 0.00021
Further Details:      
 
Domain Number 2 Region: 361-501
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 3.54e-32
Family Deoxycytidylate deaminase-like 0.00025
Further Details:      
 
Domain Number 3 Region: 202-301
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.00000000131
Family MesJ substrate recognition domain-like 0.0071
Further Details:      
 
Weak hits

Sequence:  gi|46199478|ref|YP_005145.1|
Domain Number - Region: 287-368
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0149
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|46199478|ref|YP_005145.1|
Sequence length 507
Comment cell cycle protein mesJ-like protein [Thermus thermophilus HB27]
Sequence
MDVPAFRERLLRLAPKDPLVLAVSGGGDSVALALLVKEAGRQAVVAHLDHGLRPESPLDQ
AFVRALAERLGFPFFTERVEVARIAQARGENLEAVAREVRYAFLHRVAREVGARAILTAH
TLDDQAETVLLQLLQGTARATGIREREGIVVRPLLAHTREELRAYLRARGEAWREDPTNQ
DPALDRNFLRLFVFPLLEERFPAAKRALARFAEARAEEEGVLERQAEARLLPDPRFFVPA
FRAAPLLEAPLAVRRRALRRLLEKLGLRPEARLVLLLEEALRGRPQTLPGGVLARRKGGT
LFLLPPRPRLPLPPGFRRPAPGDYLERPSGRKRLVDFLAEKGVPRELKPLWPVRAEGSRV
VEVLGLYPPPPEEAHMAEALAEAASAFREGEVPVGAVLVLPGRVLRAHNRVEGLRDPTAH
AEMLLLREAGPEARGGRLYVTLEPCLMCHHALAQAGVEVVYGAENLKEGALTRFGLPTRA
RGGVRERECAKLLRDFFARLREGCRSG
Download sequence
Identical sequences Q72IF6
WP_011173587.1.85415 262724.TTC1176 gi|46199478|ref|YP_005145.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]