SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46199516|ref|YP_005183.1| from Thermus thermophilus HB27

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46199516|ref|YP_005183.1|
Domain Number 1 Region: 38-303
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.51e-68
Family Proline dehydrohenase domain of bifunctional PutA protein 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|46199516|ref|YP_005183.1|
Sequence length 307
Comment proline dehydrogenase [Thermus thermophilus HB27]
Sequence
MNLDLAYRSFVLGVAGHPQVERLIKHRAKGLVRRYVAGETLEEALKAAEALEREGVHAIL
DLLGEMVRTEEEARAFQRGLLELVWALAGKPWPKYISLKLTQLGLDLSEDLALALLREVL
REAEPRGVFVRLDMEDSPRVEATLRLYRALREEGFSQVGIVLQSYLYRTEKDLLDLLPYR
PNLRLVKGAYREPKEVAFPDKRLIDAEYLHLGKLALKEGLYVAFATHDPRIIAELKRYTE
AMGIPRSRFEFQFLYGVRPEEQRRLAREGYTVRAYVPYGRDWYPYLTRRIAERPENLLLV
LRSLVSG
Download sequence
Identical sequences Q72IB8
gi|46199516|ref|YP_005183.1| WP_011173620.1.52262 WP_011173620.1.85415 262724.TTC1214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]