SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46199634|ref|YP_005301.1| from Thermus thermophilus HB27

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46199634|ref|YP_005301.1|
Domain Number 1 Region: 4-149
Classification Level Classification E-value
Superfamily Ribosomal protein S7 1.68e-59
Family Ribosomal protein S7 0.000000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|46199634|ref|YP_005301.1|
Sequence length 156
Comment 30S ribosomal protein S7 [Thermus thermophilus HB27]
Sequence
MARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLK
VFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRI
AHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW
Download sequence
Identical sequences A0A1J1EM94 F6DEQ6 H7GHV9 H9ZPJ8 P17291 P62667
1fjg_G 1hnw_G 1hnx_G 1hnz_G 1hr0_G 1ibk_G 1ibl_G 1ibm_G 1jgo_J 1jgp_J 1jgq_J 1ml5_J 1vvj_QG 1vvj_XG 1vy4_AG 1vy4_CG 1vy5_AG 1vy5_CG 1vy6_AG 1vy6_CG 1vy7_AG 1vy7_CG 1xmo_G 1xmq_G 1xnq_G 1xnr_G 2f4v_G 2hhh_G 2uu9_G 2uua_G 2uub_G 2uuc_G 2uxb_G 2uxc_G 2uxd_G 2vqe_G 2vqf_G 3oto_G 3t1h_G 3t1y_G 4dr1_G 4dr2_G 4dr3_G 4dr4_G 4dr5_G 4dr6_G 4dr7_G 4duy_G 4duz_G 4dv0_G 4dv1_G 4dv2_G 4dv3_G 4dv4_G 4dv5_G 4dv6_G 4dv7_G 4ji0_G 4ji1_G 4ji2_G 4ji3_G 4ji4_G 4ji5_G 4ji6_G 4ji7_G 4ji8_G 4kvb_G 4l47_QG 4l47_XG 4l71_QG 4l71_XG 4lel_QG 4lel_XG 4lf4_G 4lf5_G 4lf6_G 4lf7_G 4lf8_G 4lf9_G 4lfa_G 4lfb_G 4lfc_G 4lfz_QG 4lfz_XG 4lnt_QG 4lnt_XG 4lsk_QG 4lsk_XG 4lt8_QG 4lt8_XG 4nxm_G 4nxn_G 4p6f_QG 4p6f_XG 4p70_QG 4p70_XG 4tua_QG 4tua_XG 4tub_QG 4tub_XG 4tuc_QG 4tuc_XG 4tud_QG 4tud_XG 4tue_QG 4tue_XG 4v42_AJ 4v4i_h 4v4j_h 4v4p_BJ 4v4r_AG 4v4s_AG 4v4t_AG 4v4x_AJ 4v4y_AJ 4v4z_AJ 4v51_AG 4v51_CG 4v5a_AG 4v5a_CG 4v5c_AG 4v5c_CG 4v5d_AG 4v5d_CG 4v5e_AG 4v5e_CG 4v5f_AG 4v5f_CG 4v5g_AG 4v5g_CG 4v5j_AG 4v5j_CG 4v5k_AG 4v5k_CG 4v5l_AG 4v5m_AG 4v5n_AG 4v5p_AG 4v5p_CG 4v5q_AG 4v5q_CG 4v5r_AG 4v5r_CG 4v5s_AG 4v5s_CG 4v63_AG 4v63_CG 4v67_AG 4v67_CG 4v6a_AG 4v6a_CG 4v6f_BJ 4v6f_CJ 4v6g_AJ 4v6g_CJ 4v7j_Ag 4v7j_Bg 4v7k_Ag 4v7k_Bg 4v7l_AG 4v7l_CG 4v7m_AG 4v7m_CG 4v7w_AG 4v7w_CG 4v7x_AG 4v7x_CG 4v7y_AG 4v7y_CG 4v7z_AG 4v7z_CG 4v87_BJ 4v87_CJ 4v8a_CG 4v8a_DG 4v8b_AJ 4v8b_CJ 4v8c_CJ 4v8c_DJ 4v8d_AJ 4v8d_CJ 4v8e_BJ 4v8e_DJ 4v8f_BJ 4v8f_CJ 4v8g_AG 4v8g_CG 4v8h_AG 4v8h_CG 4v8i_AG 4v8i_CG 4v8j_AG 4v8j_CG 4v8n_AG 4v8n_CG 4v8o_AG 4v8q_BG 4v8u_AG 4v8u_CG 4v8x_AG 4v8x_CG 4v90_AG 4v95_AG 4v95_CG 4v97_AG 4v97_CG 4v9a_AJ 4v9a_CJ 4v9b_AJ 4v9b_CJ 4v9r_AG 4v9r_CG 4v9s_AG 4v9s_CG 4w2e_g 4w2f_AG 4w2f_CG 4w2g_AG 4w2g_CG 4w2h_AG 4w2h_CG 4w2i_AG 4w2i_CG 4w4g_QG 4w4g_XG 4wpo_BG 4wpo_DG 4wq1_62 4wq1_6E 4wqf_BG 4wqf_DG 4wqr_62 4wqr_6E 4wqu_BG 4wqu_DG 4wqy_BG 4wqy_DG 4wr6_62 4wr6_6E 4wra_62 4wra_6E 4wro_6E 4wsd_62 4wsd_6E 4wsm_62 4wsm_6E 4wt1_62 4wt1_6E 4wu1_62 4wu1_6E 4wzd_62 4wzd_6E 4wzo_62 4wzo_6E 4y4o_1g 4y4o_2g 4y4p_1g 4y4p_2g 4ypb_QG 4ypb_XG 4yy3_G 4yzv_QG 4yzv_XG 4z3s_1g 4z3s_2g 4z8c_1g 4z8c_2g 4zsn_QG 4zsn_XG 5br8_G 5czp_QG 5czp_XG 5d8b_DC 5d8b_HA 5dfe_QG 5dfe_XG 5dox_1g 5dox_2g 5doy_1g 5doy_2g 5e7k_62 5e7k_6E 5e81_62 5e81_6E 5el4_62 5el4_6E 5el5_62 5el5_6E 5el6_62 5el6_6E 5el7_62 5el7_6E 5hau_1g 5hau_2g 5hcp_1g 5hcp_2g 5hcq_1g 5hcq_2g 5hcr_1g 5hcr_2g 5hd1_1g 5hd1_2g 5ib7_62 5ib7_6E 5ib8_62 5ib8_6E 5ibb_62 5ibb_6E 5imq_K 5imr_K 5j30_QG 5j30_XG 5j3c_QG 5j3c_XG 5j4b_1g 5j4b_2g 5j4c_1g 5j4c_2g 5j4d_PA 5j4d_UC 5j8b_g 5lmn_G 5lmo_G 5lmp_G 5lmq_G 5lmr_G 5lms_G 5lmt_G 5lmu_G 5lmv_G 5ndj_62 5ndj_6E 5ndk_62 5ndk_6E 5v8i_1g 5v8i_2g 5vp2_1g 5vp2_2g 5vpo_QG 5vpo_XG 5vpp_QG 5vpp_XG 5w4k_1g 5w4k_2g 5wis_1g 5wis_2g 5wit_1g 5wit_2g 5zlu_M 6b4v_PA 6b4v_TC 6boh_QA 6boh_VC 6bok_OA 6bok_RC 6c5l_AG 6c5l_CG 6cae_1g 6cae_2g 6cfj_1g 6cfj_2g 6cfk_1g 6cfk_2g 6cfl_1g 6cfl_2g 6gsj_62 6gsj_6E 6gsk_62 6gsk_6E 6gsl_62 6gsl_6E gi|55981665|ref|YP_144962.1| 2ow8h 2qnhh 2uubG cath|current|1fjfG00/2-156 cath|current|1fjgG00/2-156 cath|current|1hnwG00/2-156 cath|current|1hnxG00/2-156 cath|current|1hnzG00/2-156 cath|current|1hr0G00/2-156 cath|current|1ibkG00/2-156 cath|current|1iblG00/2-156 cath|current|1ibmG00/2-156 cath|current|1vvlG00/2-156 cath|current|1vvnG00/2-156 cath|current|1vvpG00/2-156 cath|current|1vvrG00/2-156 cath|current|1vvtG00/2-156 cath|current|1vvvG00/2-156 cath|current|1vvxG00/2-156 cath|current|1vvzG00/2-156 cath|current|1vx8G00/2-156 cath|current|1vxiG00/2-156 cath|current|1vxkG00/2-156 cath|current|1vxmG00/2-156 cath|current|1vxpG00/2-156 cath|current|1vxsG00/2-156 cath|current|1vy0G00/2-156 cath|current|1vy2G00/2-156 cath|current|1xmoG00/2-156 cath|current|1xmqG00/2-156 cath|current|1xnqG00/2-156 cath|current|1xnrG00/2-156 cath|current|2f4vG00/2-156 cath|current|2hhhG00/2-156 cath|current|2i1ch00/2-156 cath|current|2j00G00/2-156 cath|current|2j02G00/2-156 cath|current|2jl5G00/2-156 cath|current|2jl7G00/2-156 cath|current|2ow8h00/2-156 cath|current|2qnhh00/2-156 cath|current|2uu9G00/2-156 cath|current|2uuaG00/2-156 cath|current|2uubG00/2-156 cath|current|2uucG00/2-156 cath|current|2uxbG00/2-156 cath|current|2uxcG00/2-156 cath|current|2uxdG00/2-156 cath|current|2v46G00/2-156 cath|current|2v48G00/2-156 cath|current|2vqeG00/2-156 cath|current|2vqfG00/2-156 cath|current|2wdgG00/2-156 cath|current|2wdhG00/2-156 cath|current|2wdkG00/2-156 cath|current|2wdmG00/2-156 cath|current|2wh1G00/2-156 cath|current|2wh3G00/2-156 cath|current|2wriG00/2-156 cath|current|2wrkG00/2-156 cath|current|2wrnG00/2-156 cath|current|2wrqG00/2-156 cath|current|2x9rG00/2-156 cath|current|2x9tG00/2-156 cath|current|2xfzG00/2-156 cath|current|2xg1G00/2-156 cath|current|2xqdG00/2-156 cath|current|2y0uG00/2-156 cath|current|2y0wG00/2-156 cath|current|2y0yG00/2-156 cath|current|2y10G00/2-156 cath|current|2y12G00/2-156 cath|current|2y14G00/2-156 cath|current|2y16G00/2-156 cath|current|2y18G00/2-156 cath|current|3d5aG00/2-156 cath|current|3d5cG00/2-156 cath|current|3f1eG00/2-156 cath|current|3f1gG00/2-156 cath|current|3huwG00/2-156 cath|current|3huyG00/2-156 cath|current|3i8gJ00/2-156 cath|current|3i8hJ00/2-156 cath|current|3i9bJ00/2-156 cath|current|3i9dJ00/2-156 cath|current|3kiqg00/2-156 cath|current|3kisg00/2-156 cath|current|3kiug00/2-156 cath|current|3kixg00/2-156 cath|current|3knhG00/2-156 cath|current|3knjG00/2-156 cath|current|3knlG00/2-156 cath|current|3knnG00/2-156 cath|current|3ogeG00/2-156 cath|current|3ogyG00/2-156 cath|current|3ohcG00/2-156 cath|current|3ohdG00/2-156 cath|current|3ohyG00/2-156 cath|current|3oi0G00/2-156 cath|current|3oi2G00/2-156 cath|current|3oi4G00/2-156 cath|current|3otoG00/2-156 cath|current|3t1hG00/2-156 cath|current|3t1yG00/2-156 cath|current|3tvfJ00/2-156 cath|current|3tvgJ00/2-156 cath|current|3uxsG00/2-156 cath|current|3uxtG00/2-156 cath|current|3uydJ00/2-156 cath|current|3uyfJ00/2-156 cath|current|3uz3J00/2-156 cath|current|3uz4J00/2-156 cath|current|3uz6J00/2-156 cath|current|3uz7J00/2-156 cath|current|3uzgJ00/2-156 cath|current|3uziJ00/2-156 cath|current|3uzlJ00/2-156 cath|current|3uzmJ00/2-156 cath|current|3v22G00/2-156 cath|current|3v24G00/2-156 cath|current|3v26G00/2-156 cath|current|3v28G00/2-156 cath|current|3v2cG00/2-156 cath|current|3v2eG00/2-156 cath|current|3v6uG00/2-156 cath|current|3v6vG00/2-156 cath|current|3zn7G00/2-156 cath|current|3zndG00/2-156 cath|current|3zvoG00/2-156 cath|current|4abrG00/2-156 cath|current|4b8fG00/2-156 cath|current|4b8hG00/2-156 cath|current|4btcG00/2-156 cath|current|4bybG00/2-156 cath|current|4bydG00/2-156 cath|current|4cr1G00/2-156 cath|current|4dh9G00/2-155 cath|current|4dhbG00/2-155 cath|current|4dr1G00/2-156 cath|current|4dr2G00/2-156 cath|current|4dr3G00/2-156 cath|current|4dr4G00/2-156 cath|current|4dr5G00/2-156 cath|current|4dr6G00/2-156 cath|current|4dr7G00/2-156 cath|current|4duyG00/2-156 cath|current|4duzG00/2-156 cath|current|4dv0G00/2-156 cath|current|4dv1G00/2-156 cath|current|4dv2G00/2-156 cath|current|4dv3G00/2-156 cath|current|4dv4G00/2-156 cath|current|4dv5G00/2-156 cath|current|4dv6G00/2-156 cath|current|4dv7G00/2-156 cath|current|4ej9G00/2-156 cath|current|4ejaG00/2-156 cath|current|4g5kJ00/2-156 cath|current|4g5mJ00/2-156 cath|current|4g5tJ00/2-156 cath|current|4g5vJ00/2-156 cath|current|4ji0G00/2-156 cath|current|4ji1G00/2-156 cath|current|4ji2G00/2-156 cath|current|4ji3G00/2-156 cath|current|4ji4G00/2-156 cath|current|4ji5G00/2-156 cath|current|4ji6G00/2-156 cath|current|4ji7G00/2-156 cath|current|4ji8G00/2-156 cath|current|4kwzG00/2-156 cath|current|4kx1G00/2-156 cath|current|4lf4G00/2-156 cath|current|4lf5G00/2-156 cath|current|4lf6G00/2-156 cath|current|4lf7G00/2-156 cath|current|4lf8G00/2-156 cath|current|4lf9G00/2-156 cath|current|4lfaG00/2-156 cath|current|4lfbG00/2-156 cath|current|4lfcG00/2-156 cath|current|4nvuG00/2-156 cath|current|4nvwG00/2-156 cath|current|4nvyG00/2-156 cath|current|4nw0G00/2-156 cath|current|4nxmG00/2-156 cath|current|4nxnG00/2-156 cath|current|4qcmG00/2-156 cath|current|4qcoG00/2-156 cath|current|4qcqG00/2-156 cath|current|4qcsG00/2-156 cath|current|4qcuG00/2-156 cath|current|4qcwG00/2-156 cath|current|4qcyG00/2-156 cath|current|4qd0G00/2-156 cath|current|4qjtg00/2-156 cath|current|4rb5G00/2-156 cath|current|4rb7G00/2-156 cath|current|4rb9G00/2-156 cath|current|4rbbG00/2-156 cath|current|4rbdG00/2-156 cath|current|4rbfG00/2-156 cath|current|4rbhG00/2-156 cath|current|4rbjG00/2-156 cath|current|4w2aH00/2-156 cath|current|4w2cH00/2-156 262724.TTC1332 300852.TTHA1696 gi|384431876|ref|YP_005641236.1| gi|386359799|ref|YP_006058044.1| gi|46199634|ref|YP_005301.1| WP_008633429.1.25090 WP_008633429.1.52262 WP_008633429.1.65589 WP_008633429.1.85415 WP_008633429.1.96068 YP_144962.1.19876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]