SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|46199906|ref|YP_005573.1| from Thermus thermophilus HB27

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46199906|ref|YP_005573.1|
Domain Number 1 Region: 105-212
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 7.59e-36
Family KorB DNA-binding domain-like 0.00000305
Further Details:      
 
Domain Number 2 Region: 24-115
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 1.65e-30
Family ParB-like nuclease domain 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|46199906|ref|YP_005573.1|
Sequence length 269
Comment chromosome partitioning protein parB [Thermus thermophilus HB27]
Sequence
MSRKPSGLGRGLEALLPKTGAGVVRLPLASIRPNPRQPRKRFAEESLKELADSIREKGLL
QPLLVRPQGDGYELVAGERRYRAALMAGLQEVPAVVKDLTDREALELALVENLQREDLSP
VEEARGYQALLEMGLTQEEVARRVGKARSTVANALRLLQLPPEALEALERGEITAGHARA
LLMLEPEDRLWGLKEILEKGLSVRQAEALRERLAMAPKRSAEPSPLSLELSRHLGLPVRV
VGGKKGKVVIQYRSLEELEALLRRLGYQA
Download sequence
Identical sequences Q72H91
gi|46199906|ref|YP_005573.1| 262724.TTC1604 WP_011173975.1.85415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]