SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46199958|ref|YP_005625.1| from Thermus thermophilus HB27

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46199958|ref|YP_005625.1|
Domain Number 1 Region: 12-289
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 4.85e-142
Family Methylenetetrahydrofolate reductase 0.0000000000685
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|46199958|ref|YP_005625.1|
Sequence length 296
Comment methylenetetrahydrofolate reductase [Thermus thermophilus HB27]
Sequence
MKIRDLLKARRGPLFSFEFFPPKDPEGEEALFRTLEELKAFRPAFVSITYGAMGSTRERS
VAWAQRIQSLGLNPLAHLTVAGQSRKEVAEVLHRFVESGVENLLALRGDPPRGERVFRPH
PEGFRYAAELVALIRERYGDRVSVGGAAYPEGHPESESLEADLRHFKAKVEAGLDFAITQ
LFFNNAHYFGFLERARRAGIGIPILPGIMPVTSYRQLRRFTEVCGASIPGPLLAKLERHQ
DDPKAVLEIGVEHAVRQVAELLEAGVEGVHFYTLNKSPATRMVLERLGLRPASGQP
Download sequence
Identical sequences Q5SLG6 Q72H39
262724.TTC1656 300852.TTHA0327 WP_011174022.1.52262 WP_011174022.1.85415 YP_143593.1.19876 gi|55980296|ref|YP_143593.1| 1v93A gi|46199958|ref|YP_005625.1| ttk003000187.1 cath|current|1v93A00/1-292 1v93_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]