SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46200249|ref|YP_005916.1| from Thermus thermophilus HB27

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46200249|ref|YP_005916.1|
Domain Number 1 Region: 83-215
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 1.44e-48
Family Molybdopterin synthase subunit MoaE 0.0000648
Further Details:      
 
Domain Number 2 Region: 1-77
Classification Level Classification E-value
Superfamily MoaD/ThiS 3.55e-19
Family MoaD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|46200249|ref|YP_005916.1|
Sequence length 223
Comment molybdopterin (MPT) converting factor, subunit 2 [Thermus thermophilus HB27]
Sequence
MRIEVRLFALYREQAGTDRLALELPEGARVREAQKALEERFPGLRLEGGMAAVNQALAGA
ETPLKEGDEVAFLPPVSGGQDSYGLTQEPLDLEALVAWATAPEYGAVVSFLGTTRSPNRG
EEVAFLEYEAYPEMAEKVMAEILAEMRARWPLGRIALWHRLGRVDPGEASIAIVVSARHR
KEAFAACQYAIDRVKQILPVWKKEHRKDGSFWVEGFAPEDKRL
Download sequence
Identical sequences Q72GA1
262724.TTC1947 WP_011174298.1.85415 gi|46200249|ref|YP_005916.1| UR112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]