SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46255190|ref|YP_006102.1| from Thermus thermophilus HB27

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46255190|ref|YP_006102.1|
Domain Number 1 Region: 1-113
Classification Level Classification E-value
Superfamily AF1862-like 3.27e-31
Family Cas Cmr5-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|46255190|ref|YP_006102.1|
Sequence length 114
Comment hypothetical protein TT_P0119 [Thermus thermophilus HB27]
Sequence
MRTRSQVWAQKAYEKVREAAKGEGRGEYRDMALKLPVLVRQAGLSQALAFVDSRGKEAHK
ALGNHLAQVLGYRDLRELAEAAREAELLQYLRLTREVLAAAEWFKRFAQALIEE
Download sequence
Identical sequences Q746D6
gi|46255190|ref|YP_006102.1| gi|46255190|ref|YP_006102.1|NC_005838 WP_011174445.1.85415 262724.TT_P0119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]