SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr10P01300_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr10P01300_001
Domain Number 1 Region: 371-429
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000432
Family PHD domain 0.0089
Further Details:      
 
Domain Number 2 Region: 284-341
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000265
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr10P01300_001
Sequence length 567
Comment pep:novel chromosome:MA1:10:2896038:2899164:-1 gene:GSMUA_Achr10G01300_001 transcript:GSMUA_Achr10T01300_001 description:"Hypothetical protein"
Sequence
MGKSRGVSYKKAHREPKRRRDASDDEEDKEYLFGAEDEDVEEEGFSESLDADATEEEFEF
GESTCGSEEEREIDYDDEEEDQDEAVAVEEEVESPRSMPWNGRAQRSGALVDDEEEETKD
WFRSCRRNLVALDYAEEEEDDDDHDEDFLPDDGGDDSHDEEEVSLASGKKGDLKRRTKKR
KSRVFKQKRSEKRIRRRKSDDDDDDSDFPYSKEGLLVKNRIAFHKERNKLKNVKRRKRSL
VISESSSDSDYMIFELDDLVVGGAINPPKPINTTEDEENGKEKEGDELQKQICGICLAEE
RTRTIQGELDCCAHFFCFKCIMEWSKVESRCPVCKRRFSTITKSSRSDPGFGMRKVVSIQ
VRNQVYQPSEEEIRQMLDPYGSVVCTECQQDGDDGLMLLCDICDSCAHTYCVGLGREVPE
GSWYCDCCRSATNGSSTSQNQGTVTDERARNGECLGLGTETEVAEHIHATSYFQQSISLP
PLVAVQRIDLNAPPTLEDDHGATLQDAGGVASTLSGRRAIHHRICILLSNSRRRPMFSPI
GLLTDKVESDVLTQKTEESGHHLHSAG
Download sequence
Identical sequences M0REF7
GSMUA_Achr10P01300_001 XP_009419805.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]