SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr10P07890_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr10P07890_001
Domain Number 1 Region: 67-126
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000653
Family Ankyrin repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr10P07890_001
Sequence length 614
Comment pep:novel chromosome:MA1:10:17948287:17953729:1 gene:GSMUA_Achr10G07890_001 transcript:GSMUA_Achr10T07890_001 description:"ankyrin repeat domain containing protein, expressed"
Sequence
MEDLSKYAHSPAHLAVSRRDHAGLRRIVAALPRLPKTGDVTTEQESLAGELTADAVSSVI
DRRDVPHRETPLHLAVRLRDPTSAEILMSAGADWSLQNEHGWSALQEAVCNREDAIAMII
ARHYQPLAWAKWCRRLPRIVSSITRIQDFYMEITFHFESSVIPFISRIAPSDTYRIWKRG
PNLRADMTLAGFDGFRIQRSDQTFLFLGQGAQGDNGHPPLPPGSLIVLSHKEKEITNALE
GAGAKPTEAEVAHEVALMSQTNMYRPGIDVTQAELVPHLNWRRQERAEMVGNWKTKVYDL
LNVMVSVKSRRVPGAMTDEELFTIDNDERVANGGDVDDEYEGNGAAFEGVENSESNGVSK
ERKSWFGWSGKRTSKNSGGEDTDDTKNKHLKACPENGHHKSEIAKETGDTKKGKEKSTKK
RSGNESNKHESEFKKGVRPVLWLTPDFPLKTDELLPLLDVLANKVKAVRRLRELLTTKLP
QGTFPVKLAIPIVPTIRVLITFTKFEELQQSDEFSTPLSSPTYFQESKAKETEASGSWYS
WMRGSRGGQSSDSSEGRSCKDEIDPFRIPSDYTWIDSNEKKRRMKAKKGKSKRGTNRKQS
SRSSEDKQLLDGFE
Download sequence
Identical sequences M0RGB5
GSMUA_Achr10P07890_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]