SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr10P10900_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr10P10900_001
Domain Number 1 Region: 574-630
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000184
Family PHD domain 0.00023
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr10P10900_001
Domain Number - Region: 124-211
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 0.0192
Family Iron-containing alcohol dehydrogenase 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr10P10900_001
Sequence length 670
Comment pep:novel chromosome:MA1:10:20567697:20572119:-1 gene:GSMUA_Achr10G10900_001 transcript:GSMUA_Achr10T10900_001 description:"Putative PHD finger protein At1g33420"
Sequence
MVRVDAVAVDGRPLKRARRRDEADGMLGLPDGISAGEIAPCGPFRHCVRYFIARQARVAP
PTLPRLRTWRMSSRVGDTAVDLDVVEEDVARSRRIYCDHCRIVGWSTNPVCSTRYHFIIR
NESSPSSSYEHHPCRHLFSYSDPTHLLHGVVHANGYGHLLRVNGREGGSKNLIGCDLMEY
WDRLCKLLNVSRKISVMDVSKKHGMEFRLLQAVTAGQPWYGNWGYQFGSGSFGHTTEAYR
KAVDGLSSTPLPDDRSLSTQLQKTIALYVFLSPRRLKTLRDLFCFITQQIKDCYGEKNLG
ADATEKSQDPESLPMCTWRQEDINRAENAIIKILQAVKESKWVTWRALRGATFSSIGSLE
LLDYCLRKLAGRAVADGLVVAVKCNAESNSVEYRLERASDERSSARRLCRPSKECLLHDL
RVLYDALLNPATMQPYEPRSVWEASRSSSAKILDCKQFIKHYDKNKDLVDPHPFTLRVWC
RMELADKPKNYLAPPPELLLLPLHATVADLKSEATKAFQETYLILQSFQAEQVLVNGEYA
DDATQISFLLGPDDSVQVRGRCLGGGCKLEQLRMERGTESWTVDCTCGTKDDDGERMLTC
DRCGVWKHTRCSGIDDLDEVPAKFVCGSCLSMSKRGGRGRRMYRYDTSSSWQDDDASSNT
GRDRQLAVKS
Download sequence
Identical sequences M0RH66
GSMUA_Achr10P10900_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]