SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr10P21800_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr10P21800_001
Domain Number 1 Region: 824-972
Classification Level Classification E-value
Superfamily SET domain 8.24e-46
Family Histone lysine methyltransferases 0.0057
Further Details:      
 
Domain Number 2 Region: 163-269
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.22e-20
Family PWWP domain 0.0027
Further Details:      
 
Domain Number 3 Region: 544-606
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000115
Family PHD domain 0.0099
Further Details:      
 
Domain Number 4 Region: 354-415
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000062
Family PHD domain 0.0069
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr10P21800_001
Domain Number - Region: 655-685
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0128
Family PHD domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr10P21800_001
Sequence length 975
Comment pep:novel chromosome:MA1:10:27222076:27234380:1 gene:GSMUA_Achr10G21800_001 transcript:GSMUA_Achr10T21800_001 description:"Histone-lysine N-methyltransferase ATX4"
Sequence
MIIKRSLRGQMPSLKRCKAEEPSFSDDGGGEAAEESRRKRQRDGGGSFPLEVLGDLSGAG
IPYLPDGLRHRERRKGRDGSVKPAVTPAPVVRTSRGRSQALPSRFRNSVLIDPWKKEKSK
SKANFSTTNCSTSRSTLTSLDDSMVEAEDKYLQQTPNMEESVDCYCPEDFVLGDIVWAKC
GKKNPAWPAMVIDPLQQAPENVLNSCVPGALCVMFFGYSRNGRAYSWVKQGMIFPFIDYL
DRFQGQTQLYKNKPSNFRMAIEEAFLAEHGFFGVQLDSVNTCGRVAFDQPVAKISSEVTD
SNHDQECQSKFQAVDKSGLLCESCGLKLPYGSAKKMKHISQQLLCKHCAKLLKSKQYCGI
CKKIWHHTDGGNWVCCDGCQVWVHVECDKNCGNLKDLENTDYFCPDCKSRRNFGPQDTIK
KHAPVRYDGGISQDKQPDKITVICCDMEGIYLPNEHMVLCQCSSCKARKLTLNEWERHTG
SRKKYWKTSVKVKSTRQPLGKWLELYNPSFGDQAKHSSAGNRKEKILSLLQEPYEPVLVK
WTTERCAICRWIEDWDYNKIIICNRCQIAVHQECYGALDVQNFTSWVCRACETPLLKREC
CLCPVEGGALKPTNVDDSLWVHVTCAWFQPKVSFASDETMEPATGILDIPPLSFMKVCVI
CKQMHGACTQCYTCSTYYHAMCASRAGYRMELHCLEKNGRQIIKMVSYCAHHRSPDPETV
LIMQTPSGVFSTNSLLQKMKKQSGSRLIRTDIPQEITMPSLPTRSLSASRCLIYNRKTTK
HQRENGIAHRIMGPCHHSWDSIESLNAPMEEKNQRSFSTFRERLRYLQSTEKSRVCFGKS
GIHGWGLFAHKNLQEGEMVIEYRGEQVRRSVADLREARYQVEKKDCYLFKISEEVVVDAT
DKGNIARLINHSCMPNCYARIMNVGDDQSRVVLIAKRNVSAGEELTYDYLFDPDEAEECK
VPCLCKAPNCRGFMN
Download sequence
Identical sequences M0RKA5
GSMUA_Achr10P21800_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]