SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr10P22760_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr10P22760_001
Domain Number 1 Region: 17-250
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.79e-49
Family Ankyrin repeat 0.00032
Further Details:      
 
Domain Number 2 Region: 321-377
Classification Level Classification E-value
Superfamily RING/U-box 0.000000164
Family RING finger domain, C3HC4 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr10P22760_001
Sequence length 438
Comment pep:novel chromosome:MA1:10:27811297:27814827:-1 gene:GSMUA_Achr10G22760_001 transcript:GSMUA_Achr10T22760_001 description:"E3 ubiquitin-protein ligase XB3"
Sequence
MGQGLSCASSSYDHDFFTAVQAGDLQAVDSSLKDDPSLLLRTTIYDRLSALHIAAANGRV
EVLSMILDRSVSPDVLNRDKQTPLMLAAMHGKIECVQKLLDSGANILMFDSVNGRTCLHH
AAYYGHSDCLRAILSAAKSTHVASSWGFARFVNVSDGTGATPLHLAARQKRPSCVHILVD
NGALVCASTGRYGFPGSTPLHLAARGGSLDCIRELLARGADRLQRDSSGRMPYEVALKQN
HGECAALLNPSAADPLVWPSALKFISELDSETKALLEAALMEGNREREMKILKGTTDSLT
SPAHSDKAFDDDVSEGSDAEFCSICFDRVCTIEVQDCRHQMCAQCTLAVCCHSKPNPTTL
FLPSPACPFCRSSISRLVTTKARDTGDQNTTSKPRRFRHCSSEGSSSFKGLSSAVGSFGL
MGCGSGRITDSSDMVDKL
Download sequence
Identical sequences M0RKK1
XP_009380655.1.42102 GSMUA_Achr10P22760_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]