SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr10P23050_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr10P23050_001
Domain Number 1 Region: 4-81
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000295
Family Ankyrin repeat 0.0041
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr10P23050_001
Domain Number - Region: 182-210
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000691
Family CCCH zinc finger 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr10P23050_001
Sequence length 595
Comment pep:novel chromosome:MA1:10:27951636:27954536:1 gene:GSMUA_Achr10G23050_001 transcript:GSMUA_Achr10T23050_001 description:"Zinc finger CCCH domain-containing protein 33"
Sequence
MGLQQRTPLMVAALHGSTAVLEYVLAACPSEVLRCSSSDAATALHCAASGGATSSPTAVE
LLLAASADVDALDAAGNRPGDVIARQIPAPVARSLEVTLKAPSFPRVPSPGKGGEAKQGE
KKEYPPDSTLPDIKNGIYCTDEFRMYTFKVKPCSRAYSHDWTECPFVHPGENARRRDPRK
FLYSCVPCPEFRKGSCRNGDACEYAHGVFESWLHPAQYRTRLCKDEVGCNRRVCFFAHKP
EELRTVNPMAASVTGMVTPSLGLSSPRLSPLDMATALLLMQQQQQPGSPISRLKASLSAR
DMEFNLDMLGLEGYQHKLIDNISASPRANWGKNSLVAAASGTRSSEFTDPLGPLNPSLLA
QFQGLSMKQTVPQFQSPTGIHMPQLSGYGGNLPSSPPTAVTPILGGADHSMAKAIMNSRA
ATFAKRSQSFCDRGAAAGRQPTLFATTNAAVATESALSDWGSPDGKLDWGVRGEELNKLR
KSASFDFRDKHNTSGALSTASAALDLDESDVSWVQSLVKDGPVPLGGRIDMGKQQNEHQT
NGEGDFYCPEMNSGSRNSYVFFKPVVGAFDHMVAYLPLTLDFFGICVMGVQFDAQ
Download sequence
Identical sequences M0RKN0
GSMUA_Achr10P23050_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]