SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr10P25030_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GSMUA_Achr10P25030_001
Domain Number - Region: 131-179
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000312
Family PHD domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr10P25030_001
Sequence length 279
Comment pep:novel chromosome:MA1:10:29196602:29197550:-1 gene:GSMUA_Achr10G25030_001 transcript:GSMUA_Achr10T25030_001 description:"Putative Predicted protein"
Sequence
MEPIHHAVDSGRGFFLGKISFPVLRSLHCSGLYVSETATLLIRKTQLHSFRHRVHSSQAS
RSSPFLSFLSTRLPQHYKKLKKTVLSPRITPAPCYCCVCLLIPSNNKRREKRSQQGTMKG
KEGPSSSPLTAVACCMCGDPGISDELFRCKICHFRLQHKYCSNLYPKIKHYSSCNWCLRE
GGGNSAVQESTMDQSHSLSSSSDLAAGAGFGVKFHRDVSATHLKTLNKTVKKRRTTARLS
PPAVIEKSQSDLPSLSSSRPKQAFRSKIRKFKLLEEVCS
Download sequence
Identical sequences M0RL77
GSMUA_Achr10P25030_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]