SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr10P31040_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr10P31040_001
Domain Number 1 Region: 1480-1561
Classification Level Classification E-value
Superfamily TAZ domain 5.76e-22
Family TAZ domain 0.00029
Further Details:      
 
Domain Number 2 Region: 1399-1465
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000111
Family ZZ domain 0.0058
Further Details:      
 
Domain Number 3 Region: 1278-1355
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000388
Family ZZ domain 0.01
Further Details:      
 
Domain Number 4 Region: 924-965
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000465
Family PHD domain 0.0046
Further Details:      
 
Domain Number 5 Region: 595-638
Classification Level Classification E-value
Superfamily TAZ domain 0.0000405
Family TAZ domain 0.009
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr10P31040_001
Domain Number - Region: 1159-1214
Classification Level Classification E-value
Superfamily Flavoproteins 0.0199
Family Quinone reductase 0.048
Further Details:      
 
Domain Number - Region: 45-80
Classification Level Classification E-value
Superfamily Kix domain of CBP (creb binding protein) 0.0759
Family Kix domain of CBP (creb binding protein) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr10P31040_001
Sequence length 1595
Comment pep:novel chromosome:MA1:10:33242032:33259366:-1 gene:GSMUA_Achr10G31040_001 transcript:GSMUA_Achr10T31040_001 description:"Histone acetyltransferase HAC1"
Sequence
MALRIFPNSCRLHSLCKLKMYVLIFFIFSFVSTGNIYNILQRKNQAYSEEWVRRVPELVR
RLEDRIFREAATREGYLNLALDPVDHRLCSIIKNVLNNSRPLSHHITPSSAVSTMIPTPG
ISNNGSTNTAVSVQLENPTVTARNTSVAPQTKANMANLLSTANGPPDAGNNTSLNASDGT
VCNGYQHQSANFGLGSGGSNIMSSVASTSIPRQFSQMIPTPGLNSQQAASANSECSNGTG
FSSTETPVAPQSLQQKKYAVSQNSHIFNSLGAQINAGMRSNVLHKGSPYGFSHALANGAL
GLIGNTMQLSGSAASEGVLTPNPYVSSPKPLQQHHQPRMPMRTTDITHSETFHGPDSSSL
SAMNNMNSVNLHHKLRANAGLLNYNASFKEQLLQSQQHMQQSTQQPNQTYAQFVQNQHLL
PQRQQQNQQIALMNDSLRKSSATSHFGEQLVPSHSNVTCSEPLIQSAARHVQPPDLQTQY
QQNASAEGHAKSAQFLGHLPSPRDFHVSVSEGSLQLLHSHLQSDGFSENIGHISSELQAD
ELLQFQWHPQPLKQAQMPEKQSCQQLQEELNQRIAGQDDTQQPNVSAREVDSGREDSIKQ
QDYLKQIRWLLFLHHAHRCPSRKGLCRESNCLKAQDVVTEIKTDSDGMRTDTIPTEDSGD
RQPASKRMKVQHISPFLPKVEASVVCLPSGNQHCDFQETEALECKHRTVMISANSEVVLK
MDEPTGSGHEQVPVFGSDISENKNLPTCEKDPSVSNSVNSHVKQENMVVDKMLDQSTIEI
KQDPGNQTTDQITGNKSGKPKIKGVSLIELFTPEQITEHIMGLRQWVGQSKAKAEKNQAR
ERSMTENSCQLCAVEKLTFEPPPIYCSPCGARIKRNAFYYTIGSSETRHYFCIPCYNEAR
GETIEAEGSTFLKTKLEKKRNDEETEEWWVQCDKCEVWQHQVCALFNGRRNDGEAEFTCP
NCCVKEIERGERKPLPQSAVLGAKDLPKTILSDHIERRLFRRLKQERQERSRHLGKNFDE
VPGAEGLVVRVVSSVDKKLEVKQRFLEIFQEENYPKEFPYKSKAVLLFQKIEGVEVCLFG
MYVQEFGSECSFPNQRRVYLSYLDSVKYFRPEIKTVTGEALRTFVYHEILIGYLEYCKKR
GFTSCYIWACPPLRGEDYILYCHPEIQKTPKSDKLREWYLTMLRKAAKENIVVDLTNLYD
HFFITMGECKAKVTAARLPYFDGDYWPGAAEDMIYQLRQEEDGKKQLKRGKTKMTITKRA
LKAAGQTDLSGNASKDALLMQKLGETICPMKEDFIMVHLQHACTHCCILMVSGTRWVCNQ
CKNFQLCDKCHEAEQSVDERDRHPTNSREKHMLYPVENNDVPHDTKDKDDILESEFFDTR
QAFLSLCQGNHYQYDTLRRAKHSSMMVLYHLHNPTAPAFVTTCNVCHHDIEAGQGWRCET
CPDFDVCNACYQKGGIDHPHMLTNHPSTADRDAQNKEARAKRVLQLRKMLDLLVHASQCR
SPQCQYPNCRKVKGLFRHGIQCRTRASGGCVLCKKIWYLLQIHSRACKESECSVPRCRYL
KEHLRRLQQQSDSRRRAAVMEMMRQRAAEVAADTG
Download sequence
Identical sequences M0RMX8
GSMUA_Achr10P31040_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]