SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr11P04220_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr11P04220_001
Domain Number 1 Region: 5-221
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.54e-32
Family Ankyrin repeat 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr11P04220_001
Sequence length 516
Comment pep:novel chromosome:MA1:11:3088191:3089938:1 gene:GSMUA_Achr11G04220_001 transcript:GSMUA_Achr11T04220_001 description:"Putative Predicted protein"
Sequence
MDPRLEEAAYAGDLTLFRRLLQEDRLLLHRQTIAAAHLSDSPLHIAASLGHSDLVREILA
VNPELAHGRNSEGLSALHLVAAQGHVSVVNEQLQYAAAANLCLATDNDGFMPAHAAALRG
KLDALTVLLDACPESFRAVTSQGDSILHLTVKSNSFETVQLLLNRTDENDELLNSGDAKG
NTVLHLAVARKHFQTVKLLLGRRGIEANATNMRGDTVLDMLLDSPCQHGDLLLGELIRAA
GGRTAAEEGKTQPKSSPSDARASATVASHRSRPNRWSPFRRQARPSKDDRSPRKVLSELK
ERYNNKPATLMVVATLIATITFQAGMNPPGGFKQKDAGGPTPPNAEVNFDGSSSEGEAVL
KHGLKLFLLFDMFGLFASLSIILLLICCVPRRKKTVMGILKWILWLAVFSTALAFSTAIM
RIFFYPPYTTILLLSWFGILSLFMVWVCFRAIRCLLRKGGCWKKKDREGESQGGPRRAVA
ICTKIVVGVLIIILLGVFLIVNIFVFSYIAERSMIG
Download sequence
Identical sequences M0RPA2
GSMUA_Achr11P04220_001 XP_018676327.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]