SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr11P05300_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr11P05300_001
Domain Number 1 Region: 435-506
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000658
Family PHD domain 0.0071
Further Details:      
 
Domain Number 2 Region: 362-417
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000589
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr11P05300_001
Sequence length 778
Comment pep:novel chromosome:MA1:11:3932625:3937867:-1 gene:GSMUA_Achr11G05300_001 transcript:GSMUA_Achr11T05300_001 description:"Putative Predicted protein"
Sequence
MGRGGRVVYKRAAAGRRRRRRSKASDDDDDDDDEEYVLGEEEEEESSDEPLASDGEEDEY
EFGESTGGSDEDDEQEFLAPRSKPRKAPSKPKRRVKKSRVWDDDDDDDYEEEEEEEEEDE
EEEEDRVDFSIRKKGERRKKAGVRSRRQKPRASDSEEEVREEEDDDGDEDFSPDEQDFED
EEASVISEFKRKGGNPKQGGKKRKPRALKRKKGKRSRPHRSGEDDDFIVKDRVAVDRKSK
KPKETGRRKVSTSWAIKNKSPVESDTSDFDFVTSDDDFMGDTVLLNRPEINNKYFRKTNT
KRTRGKVMVSSDKSESSLDGDYMISEEELRDLGVGGVLDQPQLKRISAGMKGDKKGKEKE
NDELGKPLCGICLSEEQRMTVRGVLNCCTHYFCFACIMEWSKVESRCPVCKRRFGTITKS
SRSDPGFGLRKAVIKVEKRDQVYQPSEEEIRRMMDPYENVVCIECHQGGDDSLMLLCDIC
DSPAHTYCVGLGREVPEGNWYCECCRSAGDGSSYLQNERIVTDQAANSSDFLVTPVRTED
VAVRDNTNLQRSGQPSMQEIDLNVSPRSVEDYGSTSQFFGAGAATLSGRRAIHQRIRILL
SNSRPRQISAETDVLRDNMASGVMTSEVRDSGENLHSSQGFSSWTRGSAAEQCHHNNRPS
VQSNANLVQCATESSSFQHVNGAKEQVHSMVKSHLKELSSGSPLDRITFKEFARRSTHTV
LAACGIKHHRRMVSVPVHPPGCCSHVSDQEQVVVTQGCCLSCFSSYVKDVVQKILHAT
Download sequence
Identical sequences M0RPL0
GSMUA_Achr11P05300_001 XP_009382511.1.42102 XP_018676509.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]