SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr11P06880_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr11P06880_001
Domain Number 1 Region: 67-126
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000126
Family Ankyrin repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr11P06880_001
Sequence length 641
Comment pep:novel chromosome:MA1:11:5425881:5430179:-1 gene:GSMUA_Achr11G06880_001 transcript:GSMUA_Achr11T06880_001 description:"ankyrin repeat domain containing protein, expressed"
Sequence
MEDLSKYAHSPAHVAVARRDHAGLRRMVAALPRLPKAGEVTTEEESLAGELTADAVSAVI
DRRDVPHRETPLHLAVRMRDPISAEILMSAGADWSLQNEHGWSALQEAVCTREDAIAMII
ARHYQPLAWAKWCRRLPRIVSSIERILDFYMEITFHFESSVIPFISRIAPSDTYRIWKRG
PNLRADMTLAGFDGFRIQRSDQTFLFLGQGAPAEDVHPPLPPGSLIVLAHKEKEITNALE
GAGAKPTEAEVAHEVALMSQTNMYRPGIDVTQAELVPHLNWRRQERAEMVGNWKTKVYDM
LNVMVSVKSRRVPGAMTDEELFTVDNDERIANGGDLDGELDDVLTPEERMQLDSALRMDN
SQGLDESEGNSGALEGVENSESNGVTKERTSWFGWSSKRTSKNTGGDDADDVKNKHVKLC
PENGHHKSESAKEMGDIKKGKEKGSKKKTGNESNKHESEFKKGVRPVLWLTPDFPLKTDE
LLPLLDILANKVKAVRRLRELLTTKLPQGTFPVKLAIPIVPTIRVLITFTKFEELQQSDE
FSTPLSSPTHFQESKAKETEGSGSWYSWVKRSRGGQSSDSSEGRSCKDEIDPFHIPSDYT
WIDATEKKRRMKAKKGKSKRGTNRKQSTRGSEDQQLLDGFE
Download sequence
Identical sequences M0RQ18
XP_009382687.1.42102 XP_009382688.1.42102 XP_009382689.1.42102 XP_018676383.1.42102 GSMUA_Achr11P06880_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]