SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr11P09250_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr11P09250_001
Domain Number 1 Region: 553-665
Classification Level Classification E-value
Superfamily ARID-like 0.0000000000000436
Family ARID domain 0.0016
Further Details:      
 
Domain Number 2 Region: 655-719
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000171
Family PHD domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr11P09250_001
Sequence length 726
Comment pep:novel chromosome:MA1:11:7130357:7139047:1 gene:GSMUA_Achr11G09250_001 transcript:GSMUA_Achr11T09250_001 description:"AT-rich interaction region, putative, expressed"
Sequence
MHQTHGFSKQTCRLVAVLCGKFTGKRNEVKRQHPYPFPELVSSGRLEVHTLVNPSVDSFR
EAQKSLKPNILYFQGSELENEEEIGTLVWGDLDVSKPDMFSALIDPPLPTTVYLEVPNGE
KIAQALHSKGTPYVIYWKNAVSSYTASHFRQALLSVLQSSCSHTWDAFQLAHASFRLYCV
RNNYVLPDNGQKESSNHGPQLLGDAPKINIVLPDRAAEEGEETSSDSLPVTKINDGDVDM
RLLICGLPCTLDACLLGSLEDGINALLNIEIRGSKLNNRMSVAHPLQDGPLSDAVVTMRC
DLTTCSSTHTSILVSDSVQSCLNDQVLENHIKNELIEKSQLVHAIPDCDQNKPPLYESLP
SVSVACGASAFEVRMKVPSWAVQVLKQLASEVSYRSLVTLGIASIQGIPVASFEKEDADR
LLFLWNRQRKEIIFRHELSSLPPLSSSVVTKRSKTFSEAKPIAFSQTMKENGIFLNDVAT
MKPVPCSRQRMLPLGIQDDVPTASSKKNNTIRVPLTPRTSMSSSFRPKQKIVPQNPLPLK
KHGCNRSSIQVCSEVEFLEDVMQFLVIRGHNRLVPQGGISKFPDAVLNAKRLDLFNLYRQ
VVSRGGFYVGNGINWKGQIFSKMQNYTASNKMTGVGNTLKKHYEMYLLEYELAHNDVDGE
CCLLCRSSAPGDWVSCGSCSEWAHLGCDRRQGLATFKDYAKTDGLEYICPNCSVNNRKMK
SQKVAK
Download sequence
Identical sequences M0RQQ5
GSMUA_Achr11P09250_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]