SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr11P12890_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr11P12890_001
Domain Number 1 Region: 10-64
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000267
Family PHD domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr11P12890_001
Sequence length 158
Comment pep:novel chromosome:MA1:11:12461903:12464180:-1 gene:GSMUA_Achr11G12890_001 transcript:GSMUA_Achr11T12890_001 description:"zinc finger protein, putative, expressed"
Sequence
MGSKGGAAPPPSSVVCCMCGDRGLMQELFRCKLCLVRSQHRYCSNFYPKAESYRTCNWCL
REEGERSLPKEAMKDTNRLVSSSSNNDSSNDSGASKLHRGDFSSQLNKPIKKPRLLDWSA
SDVTDRVWSGELSSGSGRARQVLRGKARRYKLLEEVSS
Download sequence
Identical sequences M0RRR9
GSMUA_Achr11P12890_001 XP_009383575.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]