SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr11P19340_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr11P19340_001
Domain Number 1 Region: 78-359
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.93e-58
Family Carbon-carbon bond hydrolase 0.0087
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr11P19340_001
Domain Number - Region: 560-596
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0216
Family PHD domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr11P19340_001
Sequence length 656
Comment pep:novel chromosome:MA1:11:20496992:20505685:-1 gene:GSMUA_Achr11G19340_001 transcript:GSMUA_Achr11T19340_001 description:"Putative Uncharacterized hydrolase yugF"
Sequence
MALVLLRTPSSYSPPSTTTPLLPFTTACRSPSRVPSSAGHWKRVRGLRIASGSGRGLALT
HADTSGDLKEIRDCCTVWKWKDFDVNYLVKGKGPPLLLVHGFGASVGHWRRNIGVLSECY
TVYALDLLGFGASDKPPGFAYTMEGWAQLILDFLDEVIKKPTVLVGNSVGSLACVIAASE
SNGDLVRGLVLLNCAGGMNNKAVVDDWRIKLLLPLLWLFDFLLSQRVIASALFERVKQRE
NLKNILLSVYGNKDAVDEDLIEIIKGPADDKGALDAFVSIVTGPPGPNPVSLMPKISIPV
LVLWGDRDPFTPIDGPVGKYFSSLPSNLPNIELHVLPGVGHCPHDDRPDLVHEKLLPWLS
KGSVSRLLSSSCELGLISARERAVFPSSRFGVCARDCDRFGNYKQRKKLDQMDGDRRRRA
PLKSRHPDLKEKLRQCCLERIKEERNQLLWKIRSNRQQSQETEDIVESTLREIVSDELQR
MQPSLLENQRNIVSKNNDVIWEFDGLHLENSTETASEELMLEMQRLLYEDLREELIKREL
EFFEKEDEYLAQAVLENMNLNDNQNAENNKVWCPICKRGELQENHHIICCTNCNLRFDAG
IDKLNLNFLKSRLGEVHMDHLNRGCKATPSFCMQAMFNLNALFIQCEVCDTFEIVI
Download sequence
Identical sequences M0RTL4
GSMUA_Achr11P19340_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]