SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr11P20250_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr11P20250_001
Domain Number 1 Region: 201-290
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.24e-19
Family Ankyrin repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr11P20250_001
Sequence length 432
Comment pep:novel chromosome:MA1:11:21240596:21248113:1 gene:GSMUA_Achr11G20250_001 transcript:GSMUA_Achr11T20250_001 description:"BTBA3 - Bric-a-Brac,Tramtrack, Broad Complex BTB domain with Ankyrin repeat region, expressed"
Sequence
MEESLKSLSLDYLNLLINGQAFSDVTFSVEGRLFMYSGQVSLVPQKHEPRPNCSDRGCWH
THCTAAVDLALDTLTASRSFGVEQLALLTQKQLASMVEKASIEDVMKVLMASRKQEMHQL
WTTCSHLVAKSGLPPEVLAKHLPIDVMAKIEELRLKSSLARRSFIPHHHALEVAGPSTEL
DDHHKIRRMRRALDSSDVELVKLMVMGEGLNLDDALALHYAVENCSREVVKALLELGAAD
VNCRAGPAGKTPLHVAAEMVCPDMVAVLLDHHADPNVRTFDGVTPLDILRNLTSDFLFKG
AVPGLTHIEPNKLRLCLELVQSAALVMSREEAKSGGGGAGSHPHSAIYPPMHPDSTSCTP
NNSNGSMVNLSLDSRMVYLNLGMAARLGCKMSDGGEDDDGSSRSQGGGGGNIGLSTMFPS
HGFPFHWFKPMP
Download sequence
Identical sequences M0RTV5
GSMUA_Achr11P20250_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]