SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr11P24730_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr11P24730_001
Domain Number 1 Region: 67-161
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000171
Family Ankyrin repeat 0.0042
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr11P24730_001
Domain Number - Region: 225-252
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00121
Family CCCH zinc finger 0.0037
Further Details:      
 
Domain Number - Region: 259-287
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00455
Family CCCH zinc finger 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr11P24730_001
Sequence length 587
Comment pep:novel chromosome:MA1:11:24129340:24131422:1 gene:GSMUA_Achr11G24730_001 transcript:GSMUA_Achr11T24730_001 description:"Zinc finger CCCH domain-containing protein 33"
Sequence
MCSGHRKLSPPSASGEAKQPSSETAALLLEIAASDDLAAFKRAVEDEGHPFDVAAHWYGR
SPSRGMGYQQRTPLMIAALYGSTGVMGYLLSARPAEAARRAASDGVTALHCAAAGGSPAS
LEAVKLLIGADADVVDALDASGNRPGDVVARQSLSTVAKSLGKKEYPPDSTLPDINTGIY
GTDEFRMYTFKIKPCSRAYSHDWTECPFVHPGENARRRDPRKFSYSCVPCLEFRKGSCRN
GDACEYAHGVFESWLHPAQYRTRLCKDETCCNRRVCFFAHKPEELRTVNHSAASVAGTLL
SSPRSSSPALSSLDMAMALTMMQQPGSPMSPTASSGLGAAAAWMNQAGGSMTPPALQLPS
SRLKASLSARELDFDLELLGLEGYQQKLVDGITRTASPRANRGANTLVAAAAAARAPEYT
DLLGSMHQPQLLSGYGGNQCSSPPVSSTSSFGLDHSMAKAIMNSRASAFAMRSQSFCDRG
ATAGRQSMLSAMTTAAAAGATPSLLSDWSSPDGKLEWGIQGEELNKLRKSTSFALRSNHA
TFGRVEASGPNEPDVSWVRSLVKDGLGAGEHQNADMFSPWAEEKIMA
Download sequence
Identical sequences M0RV53
GSMUA_Achr11P24730_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]