SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr11P26440_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr11P26440_001
Domain Number 1 Region: 188-248
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.02e-16
Family PHD domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr11P26440_001
Sequence length 252
Comment pep:novel chromosome:MA1:11:25247876:25253544:-1 gene:GSMUA_Achr11G26440_001 transcript:GSMUA_Achr11T26440_001 description:"PHD finger protein At5g26210"
Sequence
MDEDEVARVSRTPEEVFRDFRGRRAGMIKALTTDVDKFYQQCDPEKENLCLYGFPNETWE
VNLPAEEVPPELPEPALGINFARDGMAEKDWLSLVAVHSDAWLLAVAFYFGARFGFDKES
RRQLHNMINNLPTIYEVVTGTVKQQSREKNPNGTSKSNKSSSKKAEPQKPSKMPPSKEED
GSRVEDAEENEEHENTLCGACGDNYANDEFWICCDMCEKWFHGKCVRITPARAEHIKQYK
CPSCSNNKRGRA
Download sequence
Identical sequences M0RVM4
GSMUA_Achr11P26440_001 XP_009385124.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]