SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr1P01140_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr1P01140_001
Domain Number 1 Region: 62-130
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000404
Family Ankyrin repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr1P01140_001
Sequence length 547
Comment pep:novel chromosome:MA1:1:833783:835950:-1 gene:GSMUA_Achr1G01140_001 transcript:GSMUA_Achr1T01140_001 description:"ankyrin repeat domain containing protein, expressed"
Sequence
MAGMDPSKYAHSPAHKAVLARDYAGLKRVLAALPRLADPSSIRTEAASFAEEEKAEAISA
VVDRRDVPNRETPLHLAVRLGDAAAVEMLMAAGADYSLQNEQGWSALQEAICAREENLAK
IIIRHYQLLAWAKWCRRLPRVVATMRRMRDFYMEITFHFESSVIPFISRIAPSDTYKIWK
RGSNLRADMTLAGFDGFRIQRSDQSILFLGDGSEDGKVPPGSLCVISHKDKVVMSALNGA
GTPPTEAEVQQEVAAMSQTNIFRPGIDVTQAVLLPQLTWRRQERSEMVGPWKAKVYEMHH
VMVSMKSRQVPGAMTDEDALKVKSPDMLDQDACSSSSSRNNGQRKAVPPSVILVDSPPGH
QSRPERRSIEVVKRPATSKESEYRKGLRPILWLSPDFPLQTEELLPLLDILANKVKAIRR
LRDLLTTKLPPGTFPVKVAIPVVPTIRVLVTFSKFEELQPLEEFWTPPSSPESSRTPETQ
ASSSWIQWIKAPYRQAYAASPGPGNRVEDVQDPFGIPPDYTWTTAEARRKKTQEGTSKSK
QVKGRNR
Download sequence
Identical sequences M0RW22
GSMUA_Achr1P01140_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]