SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr1P01960_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr1P01960_001
Domain Number 1 Region: 7-242,291-316
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.03e-60
Family BAR domain 0.0023
Further Details:      
 
Domain Number 2 Region: 473-601
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.66e-37
Family Pyk2-associated protein beta ARF-GAP domain 0.00043
Further Details:      
 
Domain Number 3 Region: 255-358,395-428
Classification Level Classification E-value
Superfamily PH domain-like 3.45e-24
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 
Domain Number 4 Region: 619-771
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.18e-21
Family Ankyrin repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr1P01960_001
Sequence length 783
Comment pep:novel chromosome:MA1:1:1595206:1607640:1 gene:GSMUA_Achr1G01960_001 transcript:GSMUA_Achr1T01960_001 description:"ADP-ribosylation factor GTPase-activating protein AGD4"
Sequence
MTAFVTLEDSPMFRKQIYSLEQTTDELKDRCHKFHKGCKRFMVSLGEAYYGDLSFADSLE
AFGAGQDDPVSVAIGGPVMSKFTTAFRELGSYKELLRSQVEHMLSNRLMQFMNVDLQNVK
DCRRRFDKATAGYDQAREKFMSLKKGTRVDIVAELEEASFLYECAFERCRFNLVNALANI
EAKKKFEFLESISAVMDANMRYFKQGYELLSQMEPFIHQVLTYTQQSKEMINVEQDKLEK
RIQEFRTQSELANLRSSSNMQATTSGDGINVIGLNSYKNIEALMQSTANGEVQIIKQGYL
LKRSSNLRGDWKRRFFVLDSHGTLYYYRDKWSKQPLSCIGLHNKMLLSLEMYPEVAWKLR
SLKHTSFQGGENIGFHTVDLRTSTIKIDAEQTDLRFCFRIISPAKTFTLQAENEVDRMDW
VEKIRGVITSLLNSTLSNQLSSGGLDMDSHSFADANGVDAHLLEESTNTKGYDNISKILR
SIPGNDACAECGAPDPDWASLNLGILVCIECSGVHRNLGVHISKVRSLTLDVKVWEPAVV
DLFCALGNAYCNSVWEELLLFQDQRIDVPNVDGPSVKKPTPKDAISRKEKYIHSKYVGKS
LIVRETSQSELPLITVRIWEAIKTNNVQIAYRLFVASDAFPNTIYDEVNSELYHISDTPV
NRNNGSTERKQFDPALCQKIKDSGEPESCLDGCSLLHIACHVGDPVMLELLLQFGADINF
QDFHGRTPLHHCICTKNNSLAKYLIRRGASTSAKDGGGFTALERAMELGAITDEELFILL
AGR
Download sequence
Identical sequences M0RWA4
GSMUA_Achr1P01960_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]