SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr1P03410_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr1P03410_001
Domain Number 1 Region: 155-221
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.09e-24
Family PHD domain 0.00012
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr1P03410_001
Domain Number - Region: 23-118
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.00144
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr1P03410_001
Sequence length 229
Comment pep:novel chromosome:MA1:1:2793821:2799627:-1 gene:GSMUA_Achr1G03410_001 transcript:GSMUA_Achr1T03410_001 description:"Putative Inhibitor of growth protein 4"
Sequence
MGFVEDFQASIESVPAMLQRNYSLMRDLDKSLLGVRQQNEQRCEQEIEDIKRGIESGSIT
PDASLIRFSDEALDEQKHCIRIADEKVTLAIQAYDMVDAHIQQLDQYMRKLEELRQEREL
AAGADNAAGVSNTDPNTRSGRATESGRGGRKKSRLAAEPPGVELELPVDPNEPTYCICNQ
VSFGKMVACDNANCKIEWFHFDCVGLKEQPKGKWYCPNCIGMQKRRKGK
Download sequence
Identical sequences M0RWP9
XP_009390107.1.42102 GSMUA_Achr1P03410_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]