SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr1P09120_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr1P09120_001
Domain Number 1 Region: 145-194
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000886
Family PHD domain 0.0075
Further Details:      
 
Domain Number 2 Region: 257-341
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000000000941
Family Chromo domain 0.0097
Further Details:      
 
Domain Number 3 Region: 163-256
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000202
Family Chromo domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr1P09120_001
Sequence length 386
Comment pep:novel chromosome:MA1:1:6998133:7001727:-1 gene:GSMUA_Achr1G09120_001 transcript:GSMUA_Achr1T09120_001 description:"Uncharacterized protein"
Sequence
MKLSTATTDKVVDDKGRSRRSYSGGRKLWTSGRVSLCWFLSLGRVRTWGVIREAHDKIAS
DKHENAASCLEEYKGNSVSEAKSQLAGAEKPNCSVASACTISVKMSMEENKARSVDCDFM
DISKQLVGSNILESFVEIQKDGGPTTCVVCRRPETDLSCDGKGCNRSYHLSCLDPPLQDT
PPGVWLCIFCIKRKIEFGVYSVSEGIDSIWNIKEGLQIGKHYLVKYKGLAHVHNQWISEI
QMLQEAPTVLSKFSMKYQIERAIRWKQEWTEPHRLLQKRLLMPQKLADEFFSRLGNNFRK
CYYEWLVKWKGLGYEDATWEFETSPFLCTCEAMALMKDYEARIEAKAAFVSSNADKDAWK
LESSHVVVDMDMWSTMGRIMDIHRSF
Download sequence
Identical sequences M0RYC1
GSMUA_Achr1P09120_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]