SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr1P10240_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr1P10240_001
Domain Number 1 Region: 20-277
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.74e-51
Family Ankyrin repeat 0.00033
Further Details:      
 
Domain Number 2 Region: 320-380
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000179
Family RING finger domain, C3HC4 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr1P10240_001
Sequence length 444
Comment pep:novel chromosome:MA1:1:7722355:7726187:-1 gene:GSMUA_Achr1G10240_001 transcript:GSMUA_Achr1T10240_001 description:"Probable E3 ubiquitin-protein ligase XBOS32"
Sequence
MGFLSVIGNSFGCSTSGERLLSAAREGDLEEAKALVEYNPRLARYSTFGVNNSPLHFSAS
HGHHEIVSVLVETGANINLRNYSGQTPLMLACLHGHWEVVQILILFKANIHKKDFLSGGT
ALHFAALNGHNRCIRLLLADCVPSSPQFWNTMRGRLASEDSLVDFDEVDLCKIVNRRADG
GITALHLAALNGHAESVQLLLDLGACVSEVTVNDGATIDLIGAGSTPLHYAACGGNAVCC
QVLIARGASLTAENANGWTPLMVARSWHKNWLESILRKEPEGQIAVLPSKYLALPLMSIV
KIARECGWRKTKHEPTCVDPCAICLESKCTVAAQGCHHEFCTTCALYLCSTNNTSATVHG
PPGSVACPLCRRAIVSFIKLPGTTNMTKDLVRANLSRSLSVTHSTTRSNPATSKAKQITK
PDFQYKQIKQRSSSFRSLGFQQFL
Download sequence
Identical sequences M0RYN3
GSMUA_Achr1P10240_001 XP_009396900.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]