SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr1P10470_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr1P10470_001
Domain Number 1 Region: 42-101
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000842
Family PHD domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr1P10470_001
Sequence length 302
Comment pep:novel chromosome:MA1:1:7901192:7910514:1 gene:GSMUA_Achr1G10470_001 transcript:GSMUA_Achr1T10470_001 description:"PHD-finger domain containing protein, putative, expressed"
Sequence
MELVGEFASARELCIYVLKTHGLLGKSCASSNYAASESLCDGSTNLSQKCKACRLFDDPL
KMLICDHCEEAYHPSCCIPRVKKLPVDEWYCQPCFKKKPKPLLSQSHDTEGENSNHTNRI
SCRGYSISFMLTDNKPYTSGARIGKDFQVEVPDCSGPVSNEDDYFDEPSEIDSAHSVNLN
GWTDGKPQKPSSIGNWVQCREVLCSDGSDEGIVCGKWRRAPLFVVQSEDWDCSCSVLWDP
FHADCAVPQELETEEVLKHLKFTKWVCWTPIFIKQASVFCNTIVAYSCTFDPKILSWKKG
EK
Download sequence
Identical sequences M0RYQ6
GSMUA_Achr1P10470_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]