SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr1P18360_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr1P18360_001
Domain Number 1 Region: 855-1000
Classification Level Classification E-value
Superfamily SET domain 9.29e-43
Family Histone lysine methyltransferases 0.0048
Further Details:      
 
Domain Number 2 Region: 248-343
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.43e-19
Family PWWP domain 0.0082
Further Details:      
 
Domain Number 3 Region: 551-625
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000111
Family PHD domain 0.016
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr1P18360_001
Domain Number - Region: 663-702
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000487
Family PHD domain 0.046
Further Details:      
 
Domain Number - Region: 168-200
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0481
Family Tudor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr1P18360_001
Sequence length 1027
Comment pep:novel chromosome:MA1:1:13723836:13736604:-1 gene:GSMUA_Achr1G18360_001 transcript:GSMUA_Achr1T18360_001 description:"Histone-lysine N-methyltransferase ATX2"
Sequence
MALALEEFVHEEEDVDHPVRYLPLGHVYSSSASCSSARQPILVYQRRIKKPCVGSPKRRV
ESCSERSEEGSDRGRSNGVVDSLGDGQIAKKRRIMKYELLRLGSGSGSLNGNAAPRSRAG
EGCKRANSAEPKKHVRGAQKDSSALGKVKRWVELEFKGADPQVLIGLVFWPMDDDWYKGS
VTEYNPLTTQHRVEYEDGEIEHLILSSERIKFHLSCEDLEHLHLKCGVPNLEKKGPNYNE
LLALALSFHDCQDLEPGELVWAKLTGHAMWPAVVVSESNFGPRGDLKPTRINQSILVQFF
GTHDFARIKLKQAIPFLNGLLSSLHLKCKQARFYRSLDEAKMYLIEQQLPKSMLHLQKRI
EADDIKSASGEDEGTKSDDDLSTGYIINAVELASTSPIEIGNLRVTSLGKIVCDSDYFHN
KKHIWPEGYTAFRKFTSLEDPCSVMSYRMEVLRNPKVKARPLFRVTTDDGEQIDGSTPNA
CWKEIYSRIRNKQCDDTQTEVEGSGLQKSGSYMFGFSNPHIAQLIQELPNSRVCSKYFDS
YGDMPMGYRAVRVDWKDLDRCGVCDMDEEYEDNLFLQCDKCRIMVHAKCYGELEPLDGVL
WLCNLCRPGAPKFPPRCCLCPVIGGAIKPTTDGRWAHLTCAMWIPETCLVDVKRMEPIDG
ISRINKDRWKLLCSICGVSYGACIQCSHNTCRVAYHPLCARAAGLCVELEDEDKIHLMSL
DEDDDQCIRLLSFCKKHRQPSNERPPADDSLRVPTQLGSSYVPASNPSGCARSEPYNFSG
RRGQKQPQILGAASQKRLFVENKPYLVTGFRQNGSACGLSGNISAQAQCTLDDLKLGASQ
FEKHGSVCSMAEKYRNMKATFRRRLAFGKSKIHGFGVFAKLAHKAGDMVIEYIGELVRPT
IADIRERRIYNSLVGAGTYMFRIDDERVIDATRAGSIAHLINHSCEPNCYSRVISVNGDE
HIIIFAKRDIEQWEELTYDYRFFSIDERLACYCGFSRCRGIVNDTEAEEQVAKIRVPLSE
LVQWKGE
Download sequence
Identical sequences M0S0Z4
GSMUA_Achr1P18360_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]